LOCUS       BT019911                 627 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens cysteine-rich protein 2 mRNA, complete cds.
ACCESSION   BT019911
VERSION     BT019911.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 627)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 627)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..627
                     /db_xref="H-InvDB:HIT000266723"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01210X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..627
                     /codon_start=1
                     /product="cysteine-rich protein 2"
                     /protein_id="AAV38714.1"
                     /translation="MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGH
                     AEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERK
                     ASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTL
                     TPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP"
BASE COUNT          129 a          211 c          207 g           80 t
ORIGIN      
        1 atggcctcca aatgccccaa gtgcgacaag accgtgtact tcgccgagaa ggtgagctcc
       61 ctggggaagg actggcacaa gttctgcctc aagtgcgagc gctgcagcaa gacgctgacg
      121 cccgggggcc acgccgagca tgacgggaag ccgttctgcc acaagccgtg ctacgccacc
      181 ctgttcggac ccaaaggcgt gaacatcggg ggcgcgggct cctacatcta cgagaagccc
      241 ctggcggagg ggccgcaggt caccggcccc atcgaggtcc ccgcggcccg agcagaggag
      301 cggaaggcga gcggcccccc gaaggggccc agcagagcct ccagtgtcac cactttcacc
      361 ggggagccca acacgtgccc gcgctgcagc aagaaggtgt acttcgctga gaaggtgacg
      421 tctctgggca aggattggca ccggccctgc ctgcgctgcg agcgctgcgg gaagacactg
      481 acccccggcg ggcacgcgga gcacgacggc cagccctact gccacaagcc ctgctatgga
      541 atcctcttcg gacccaaggg agtgaacacc ggtgcggtgg gcagctacat ctatgaccgg
      601 gaccccgaag gcaaggtcca gccctag
//