LOCUS BT019911 627 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens cysteine-rich protein 2 mRNA, complete cds. ACCESSION BT019911 VERSION BT019911.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 627) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 627) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..627 /db_xref="H-InvDB:HIT000266723" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01210X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..627 /codon_start=1 /product="cysteine-rich protein 2" /protein_id="AAV38714.1" /translation="MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGH AEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERK ASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTL TPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP" BASE COUNT 129 a 211 c 207 g 80 t ORIGIN 1 atggcctcca aatgccccaa gtgcgacaag accgtgtact tcgccgagaa ggtgagctcc 61 ctggggaagg actggcacaa gttctgcctc aagtgcgagc gctgcagcaa gacgctgacg 121 cccgggggcc acgccgagca tgacgggaag ccgttctgcc acaagccgtg ctacgccacc 181 ctgttcggac ccaaaggcgt gaacatcggg ggcgcgggct cctacatcta cgagaagccc 241 ctggcggagg ggccgcaggt caccggcccc atcgaggtcc ccgcggcccg agcagaggag 301 cggaaggcga gcggcccccc gaaggggccc agcagagcct ccagtgtcac cactttcacc 361 ggggagccca acacgtgccc gcgctgcagc aagaaggtgt acttcgctga gaaggtgacg 421 tctctgggca aggattggca ccggccctgc ctgcgctgcg agcgctgcgg gaagacactg 481 acccccggcg ggcacgcgga gcacgacggc cagccctact gccacaagcc ctgctatgga 541 atcctcttcg gacccaaggg agtgaacacc ggtgcggtgg gcagctacat ctatgaccgg 601 gaccccgaag gcaaggtcca gccctag //