LOCUS BT019878 1092 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens diptheria toxin resistance protein required for diphthamide biosynthesis-like 1 (S. cerevisiae) mRNA, complete cds. ACCESSION BT019878 VERSION BT019878.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1092) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 1092) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..1092 /db_xref="H-InvDB:HIT000266705" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01214X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..1092 /note="Mutations: 324:OK;833:S->F;1091:OK" /codon_start=1 /product="diptheria toxin resistance protein required for diphthamide biosynthesis-like 1 (S. cerevisiae)" /protein_id="AAV38681.1" /translation="MPEGLLLFACTIVDILERFTEAEVMVMGDVTYGACCVDDFTARA LGADFLVHYGHSCLIPMDTSAQDFRVLYVFVDIRIDTTHLLDSLRLTFPPATALALVS TIQFVSTLQAAAQELKAEYRVSVPQCKPLSPGEILGCTSPRLSKEVEAVVYLGDGRFH LESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEAIATARSAKSWGLILGTLG RQGSPKILEHLESRLRALGLSFVRLLLSEIFPSKLSLLPEVDVWVQVACPRLSIDWGT AFPKPLLTPYEAAVALRDISWQQPYPMDFYAGSSLGPWTVNHGQDRRPHAPGRPARGK VQEGSARPPSAVACEDCSCRDEKVAPLAP" BASE COUNT 190 a 350 c 318 g 234 t ORIGIN 1 atgccggaag gcctcctcct ctttgcctgt accattgtgg atatcttgga aaggttcacg 61 gaggccgaag tgatggtgat gggtgacgtg acctacgggg cttgctgtgt ggatgacttc 121 acagcgaggg ccctgggagc tgacttcttg gtgcactacg gccacagttg cctgattccc 181 atggacacct cggcccaaga cttccgggtg ctgtacgtct ttgtggacat ccggatagac 241 actacacacc tcctggactc tctccgcctc acctttcccc cagccactgc ccttgccctg 301 gtcagcacca ttcagtttgt gtcaaccttg caggcagccg cccaggagct gaaagccgag 361 tatcgtgtga gtgtcccaca gtgcaagccc ctgtcccctg gagagatcct gggctgcaca 421 tccccccgac tgtccaaaga ggtggaggcc gttgtgtatc ttggagatgg ccgcttccat 481 ctggagtctg tcatgattgc caaccccaat gtccccgctt accggtatga cccatatagc 541 aaagtcctat ccagagaaca ctatgaccac cagcgcatgc aggctgctcg ccaagaagcc 601 atagccactg cccgctcagc taagtcctgg ggccttattc tgggcacttt gggccgccag 661 ggcagtccta agatcctgga gcacctggaa tctcgactcc gagccttggg cctttccttt 721 gtgaggctgc tgctctctga gatcttcccc agcaagctta gcctacttcc cgaggtggat 781 gtgtgggtgc aggtggcatg tccacgtctc tccattgact ggggcacagc cttccccaag 841 ccgctgctga caccctatga ggcggccgtg gctctgaggg acatttcctg gcagcagccc 901 tacccgatgg acttctacgc tggcagctcc ttggggccct ggacggtgaa ccacggccag 961 gaccgccgtc cccacgcccc gggccggccc gcgcggggga aggtgcagga ggggtccgcg 1021 cgtccccctt cggccgtggc ttgcgaggac tgcagctgca gggacgagaa ggtggcgccg 1081 ctggctcctt ag //