LOCUS       BT019878                1092 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens diptheria toxin resistance protein required for
            diphthamide biosynthesis-like 1 (S. cerevisiae) mRNA, complete cds.
ACCESSION   BT019878
VERSION     BT019878.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1092)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1092)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..1092
                     /db_xref="H-InvDB:HIT000266705"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01214X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..1092
                     /note="Mutations: 324:OK;833:S->F;1091:OK"
                     /codon_start=1
                     /product="diptheria toxin resistance protein required for
                     diphthamide biosynthesis-like 1 (S. cerevisiae)"
                     /protein_id="AAV38681.1"
                     /translation="MPEGLLLFACTIVDILERFTEAEVMVMGDVTYGACCVDDFTARA
                     LGADFLVHYGHSCLIPMDTSAQDFRVLYVFVDIRIDTTHLLDSLRLTFPPATALALVS
                     TIQFVSTLQAAAQELKAEYRVSVPQCKPLSPGEILGCTSPRLSKEVEAVVYLGDGRFH
                     LESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEAIATARSAKSWGLILGTLG
                     RQGSPKILEHLESRLRALGLSFVRLLLSEIFPSKLSLLPEVDVWVQVACPRLSIDWGT
                     AFPKPLLTPYEAAVALRDISWQQPYPMDFYAGSSLGPWTVNHGQDRRPHAPGRPARGK
                     VQEGSARPPSAVACEDCSCRDEKVAPLAP"
BASE COUNT          190 a          350 c          318 g          234 t
ORIGIN      
        1 atgccggaag gcctcctcct ctttgcctgt accattgtgg atatcttgga aaggttcacg
       61 gaggccgaag tgatggtgat gggtgacgtg acctacgggg cttgctgtgt ggatgacttc
      121 acagcgaggg ccctgggagc tgacttcttg gtgcactacg gccacagttg cctgattccc
      181 atggacacct cggcccaaga cttccgggtg ctgtacgtct ttgtggacat ccggatagac
      241 actacacacc tcctggactc tctccgcctc acctttcccc cagccactgc ccttgccctg
      301 gtcagcacca ttcagtttgt gtcaaccttg caggcagccg cccaggagct gaaagccgag
      361 tatcgtgtga gtgtcccaca gtgcaagccc ctgtcccctg gagagatcct gggctgcaca
      421 tccccccgac tgtccaaaga ggtggaggcc gttgtgtatc ttggagatgg ccgcttccat
      481 ctggagtctg tcatgattgc caaccccaat gtccccgctt accggtatga cccatatagc
      541 aaagtcctat ccagagaaca ctatgaccac cagcgcatgc aggctgctcg ccaagaagcc
      601 atagccactg cccgctcagc taagtcctgg ggccttattc tgggcacttt gggccgccag
      661 ggcagtccta agatcctgga gcacctggaa tctcgactcc gagccttggg cctttccttt
      721 gtgaggctgc tgctctctga gatcttcccc agcaagctta gcctacttcc cgaggtggat
      781 gtgtgggtgc aggtggcatg tccacgtctc tccattgact ggggcacagc cttccccaag
      841 ccgctgctga caccctatga ggcggccgtg gctctgaggg acatttcctg gcagcagccc
      901 tacccgatgg acttctacgc tggcagctcc ttggggccct ggacggtgaa ccacggccag
      961 gaccgccgtc cccacgcccc gggccggccc gcgcggggga aggtgcagga ggggtccgcg
     1021 cgtccccctt cggccgtggc ttgcgaggac tgcagctgca gggacgagaa ggtggcgccg
     1081 ctggctcctt ag
//