LOCUS BT019845 888 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens cyclin D1 (PRAD1: parathyroid adenomatosis 1) mRNA, complete cds. ACCESSION BT019845 VERSION BT019845.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 888) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 888) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..888 /db_xref="H-InvDB:HIT000266689" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01241X1.1" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..888 /note="Mutations: 388:G->N;389:G->N;562:S->L;563:S->L;564:S->L" /codon_start=1 /product="cyclin D1 (PRAD1: parathyroid adenomatosis 1)" /protein_id="AAV38648.1" /translation="MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSY FKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLL GATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDF IEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLR SPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEE EEEEVDLACTPTDVRDVDI" BASE COUNT 198 a 277 c 265 g 148 t ORIGIN 1 atggaacacc agctcctgtg ctgcgaagtg gaaaccatcc gccgcgcgta ccccgatgcc 61 aacctcctca acgaccgggt gctgcgggcc atgctgaagg cggaggagac ctgcgcgccc 121 tcggtgtcct acttcaaatg tgtgcagaag gaggtcctgc cgtccatgcg gaagatcgtc 181 gccacctgga tgctggaggt ctgcgaggaa cagaagtgcg aggaggaggt cttcccgctg 241 gccatgaact acctggaccg cttcctgtcg ctggagcccg tgaaaaagag ccgcctgcag 301 ctgctggggg ccacttgcat gttcgtggcc tctaagatga aggagaccat ccccctgacg 361 gccgagaagc tgtgcatcta caccgacaac tccatccggc ccgaggagct gctgcaaatg 421 gagctgctcc tggtgaacaa gctcaagtgg aacctggccg caatgacccc gcacgatttc 481 attgaacact tcctctccaa aatgccagag gcggaggaga acaaacagat catccgcaaa 541 cacgcgcaga ccttcgttgc cctctgtgcc acagatgtga agttcatttc caatccgccc 601 tccatggtgg cagcggggag cgtggtggcc gcagtgcaag gcctgaacct gaggagcccc 661 aacaacttcc tgtcctacta ccgcctcaca cgcttcctct ccagagtgat caagtgtgac 721 ccagactgcc tccgggcctg ccaggagcag atcgaagccc tgctggagtc aagcctgcgc 781 caggcccagc agaacatgga ccccaaggcc gccgaggagg aggaagagga ggaggaggag 841 gtggacctgg cttgcacacc caccgacgtg cgggacgtgg acatctag //