LOCUS       BT019845                 888 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens cyclin D1 (PRAD1: parathyroid adenomatosis 1) mRNA,
            complete cds.
ACCESSION   BT019845
VERSION     BT019845.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 888)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 888)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..888
                     /db_xref="H-InvDB:HIT000266689"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01241X1.1"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..888
                     /note="Mutations:
                     388:G->N;389:G->N;562:S->L;563:S->L;564:S->L"
                     /codon_start=1
                     /product="cyclin D1 (PRAD1: parathyroid adenomatosis 1)"
                     /protein_id="AAV38648.1"
                     /translation="MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSY
                     FKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLL
                     GATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDF
                     IEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLR
                     SPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEE
                     EEEEVDLACTPTDVRDVDI"
BASE COUNT          198 a          277 c          265 g          148 t
ORIGIN      
        1 atggaacacc agctcctgtg ctgcgaagtg gaaaccatcc gccgcgcgta ccccgatgcc
       61 aacctcctca acgaccgggt gctgcgggcc atgctgaagg cggaggagac ctgcgcgccc
      121 tcggtgtcct acttcaaatg tgtgcagaag gaggtcctgc cgtccatgcg gaagatcgtc
      181 gccacctgga tgctggaggt ctgcgaggaa cagaagtgcg aggaggaggt cttcccgctg
      241 gccatgaact acctggaccg cttcctgtcg ctggagcccg tgaaaaagag ccgcctgcag
      301 ctgctggggg ccacttgcat gttcgtggcc tctaagatga aggagaccat ccccctgacg
      361 gccgagaagc tgtgcatcta caccgacaac tccatccggc ccgaggagct gctgcaaatg
      421 gagctgctcc tggtgaacaa gctcaagtgg aacctggccg caatgacccc gcacgatttc
      481 attgaacact tcctctccaa aatgccagag gcggaggaga acaaacagat catccgcaaa
      541 cacgcgcaga ccttcgttgc cctctgtgcc acagatgtga agttcatttc caatccgccc
      601 tccatggtgg cagcggggag cgtggtggcc gcagtgcaag gcctgaacct gaggagcccc
      661 aacaacttcc tgtcctacta ccgcctcaca cgcttcctct ccagagtgat caagtgtgac
      721 ccagactgcc tccgggcctg ccaggagcag atcgaagccc tgctggagtc aagcctgcgc
      781 caggcccagc agaacatgga ccccaaggcc gccgaggagg aggaagagga ggaggaggag
      841 gtggacctgg cttgcacacc caccgacgtg cgggacgtgg acatctag
//