LOCUS       BT019827                 417 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens cellular retinoic acid binding protein 2 mRNA,
            complete cds.
ACCESSION   BT019827
VERSION     BT019827.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 417)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 417)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..417
                     /db_xref="H-InvDB:HIT000266677"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01252X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..417
                     /note="Mutations: 416:OK"
                     /codon_start=1
                     /product="cellular retinoic acid binding protein 2"
                     /protein_id="AAV38630.1"
                     /translation="MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEI
                     KQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLK
                     GEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE"
BASE COUNT          117 a           89 c          133 g           78 t
ORIGIN      
        1 atgcccaact tctctggcaa ctggaaaatc atccgatcgg aaaacttcga ggaattgctc
       61 aaagtgctgg gggtgaatgt gatgctgagg aagattgctg tggctgcagc gtccaagcca
      121 gcagtggaga tcaaacagga gggagacact ttctacatca aaacctccac caccgtgcgc
      181 accacagaga ttaacttcaa ggttggggag gagtttgagg agcagactgt ggatgggagg
      241 ccctgtaaga gcctggtgaa atgggagagt gagaataaaa tggtctgtga gcagaagctc
      301 ctgaagggag agggccccaa gacctcgtgg accagagaac tgaccaacga tggggaactg
      361 atcctgacca tgacggcgga tgacgttgtg tgcaccaggg tctacgtccg agagtag
//