LOCUS BT019827 417 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens cellular retinoic acid binding protein 2 mRNA, complete cds. ACCESSION BT019827 VERSION BT019827.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 417) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 417) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..417 /db_xref="H-InvDB:HIT000266677" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01252X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..417 /note="Mutations: 416:OK" /codon_start=1 /product="cellular retinoic acid binding protein 2" /protein_id="AAV38630.1" /translation="MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEI KQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLK GEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE" BASE COUNT 117 a 89 c 133 g 78 t ORIGIN 1 atgcccaact tctctggcaa ctggaaaatc atccgatcgg aaaacttcga ggaattgctc 61 aaagtgctgg gggtgaatgt gatgctgagg aagattgctg tggctgcagc gtccaagcca 121 gcagtggaga tcaaacagga gggagacact ttctacatca aaacctccac caccgtgcgc 181 accacagaga ttaacttcaa ggttggggag gagtttgagg agcagactgt ggatgggagg 241 ccctgtaaga gcctggtgaa atgggagagt gagaataaaa tggtctgtga gcagaagctc 301 ctgaagggag agggccccaa gacctcgtgg accagagaac tgaccaacga tggggaactg 361 atcctgacca tgacggcgga tgacgttgtg tgcaccaggg tctacgtccg agagtag //