LOCUS       BT019825                 510 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens cytochrome c oxidase subunit IV isoform 1 mRNA,
            complete cds.
ACCESSION   BT019825
VERSION     BT019825.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 510)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 510)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..510
                     /db_xref="H-InvDB:HIT000266676"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01251X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..510
                     /note="Mutations: 509:OK"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit IV isoform 1"
                     /protein_id="AAV38628.1"
                     /translation="MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDH
                     PLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKT
                     VVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKW
                     DYEKNEWKK"
BASE COUNT          128 a          118 c          155 g          109 t
ORIGIN      
        1 atgttggcta ccagggtatt tagcctagtt ggcaagcgag caatttccac ctctgtgtgt
       61 gtacgagctc atgaaagtgt tgtgaagagc gaagactttt cgctcccagc ttatatggat
      121 cggcgtgacc accccttgcc ggaggtggcc catgtcaagc acctgtctgc cagccagaag
      181 gcactgaagg agaaggagaa ggcctcctgg agcagcctct ccatggatga gaaagtcgag
      241 ttgtatcgca ttaagttcaa ggagagcttt gctgagatga acaggggctc gaacgagtgg
      301 aagacggttg tgggcggtgc catgttcttc atcggtttca ccgcgctcgt tatcatgtgg
      361 cagaagcact atgtgtacgg ccccctcccg caaagctttg acaaagagtg ggtggccaag
      421 cagaccaaga ggatgctgga catgaaggtg aaccccatcc agggcttagc ctccaagtgg
      481 gactacgaaa agaacgagtg gaagaagtag
//