LOCUS BT019825 510 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens cytochrome c oxidase subunit IV isoform 1 mRNA, complete cds. ACCESSION BT019825 VERSION BT019825.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 510) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 510) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..510 /db_xref="H-InvDB:HIT000266676" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01251X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..510 /note="Mutations: 509:OK" /codon_start=1 /product="cytochrome c oxidase subunit IV isoform 1" /protein_id="AAV38628.1" /translation="MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDH PLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKT VVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKW DYEKNEWKK" BASE COUNT 128 a 118 c 155 g 109 t ORIGIN 1 atgttggcta ccagggtatt tagcctagtt ggcaagcgag caatttccac ctctgtgtgt 61 gtacgagctc atgaaagtgt tgtgaagagc gaagactttt cgctcccagc ttatatggat 121 cggcgtgacc accccttgcc ggaggtggcc catgtcaagc acctgtctgc cagccagaag 181 gcactgaagg agaaggagaa ggcctcctgg agcagcctct ccatggatga gaaagtcgag 241 ttgtatcgca ttaagttcaa ggagagcttt gctgagatga acaggggctc gaacgagtgg 301 aagacggttg tgggcggtgc catgttcttc atcggtttca ccgcgctcgt tatcatgtgg 361 cagaagcact atgtgtacgg ccccctcccg caaagctttg acaaagagtg ggtggccaag 421 cagaccaaga ggatgctgga catgaaggtg aaccccatcc agggcttagc ctccaagtgg 481 gactacgaaa agaacgagtg gaagaagtag //