LOCUS       BT019788                 951 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens heme oxygenase (decycling) 2 mRNA, complete cds.
ACCESSION   BT019788
VERSION     BT019788.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 951)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 951)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..951
                     /db_xref="H-InvDB:HIT000266656"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01276X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..951
                     /note="Mutations: 309:OK;950:OK"
                     /codon_start=1
                     /product="heme oxygenase (decycling) 2"
                     /protein_id="AAV38591.1"
                     /translation="MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEA
                     HDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPME
                     LHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGD
                     LSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKER
                     IVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGA
                     LEGSSCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM"
BASE COUNT          258 a          242 c          284 g          167 t
ORIGIN      
        1 atgtcagcgg aagtggaaac ctcagagggg gtagacgagt cagaaaaaaa gaactctggg
       61 gccctagaaa aggagaacca aatgagaatg gctgacctct cggagctcct gaaggaaggg
      121 accaaggaag cacacgaccg ggcagaaaac acccagtttg tcaaggactt cttgaaaggc
      181 aacattaaga aggagctgtt taagctggcc accacggcac tttacttcac atactcagcc
      241 ctcgaggagg aaatggagcg caacaaggac catccagcct ttgccccttt gtacttcccc
      301 atggagctac accggaagga ggcgctgacc aaggacatgg agtatttctt tggtgaaaac
      361 tgggaggagc aggtgcagtg ccccaaggct gcccagaagt acgtggagcg gatccactac
      421 atagggcaga acgagccgga gctactggtg gcccatgcat acacccgcta catgggggat
      481 ctctcggggg gccaggtgct gaagaaggtg gcccagcgag cactgaaact ccccagcaca
      541 ggggaaggga cccagttcta cctgtttgag aatgtggaca atgcccagca gttcaagcag
      601 ctctaccggg ccaggatgaa cgccctggac ctgaacatga agaccaaaga gaggatcgtg
      661 gaggaggcca acaaggcttt tgagtataac atgcagatat tcaatgaact ggaccaggcc
      721 ggctccacac tggccagaga gaccttggag gatgggttcc ctgtacacga tgggaaagga
      781 gacatgcgta aatgcccttt ctacgctgct gaacaagaca aaggtgccct ggagggcagc
      841 agctgtccct tccgaacagc tatggctgtg ctgaggaagc ccagcctcca gttcatcctg
      901 gccgctggtg tggccctagc tgctggactc ttggcctggt actacatgta g
//