LOCUS BT019788 951 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens heme oxygenase (decycling) 2 mRNA, complete cds. ACCESSION BT019788 VERSION BT019788.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 951) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 951) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..951 /db_xref="H-InvDB:HIT000266656" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01276X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..951 /note="Mutations: 309:OK;950:OK" /codon_start=1 /product="heme oxygenase (decycling) 2" /protein_id="AAV38591.1" /translation="MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEA HDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPME LHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGD LSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKER IVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGA LEGSSCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM" BASE COUNT 258 a 242 c 284 g 167 t ORIGIN 1 atgtcagcgg aagtggaaac ctcagagggg gtagacgagt cagaaaaaaa gaactctggg 61 gccctagaaa aggagaacca aatgagaatg gctgacctct cggagctcct gaaggaaggg 121 accaaggaag cacacgaccg ggcagaaaac acccagtttg tcaaggactt cttgaaaggc 181 aacattaaga aggagctgtt taagctggcc accacggcac tttacttcac atactcagcc 241 ctcgaggagg aaatggagcg caacaaggac catccagcct ttgccccttt gtacttcccc 301 atggagctac accggaagga ggcgctgacc aaggacatgg agtatttctt tggtgaaaac 361 tgggaggagc aggtgcagtg ccccaaggct gcccagaagt acgtggagcg gatccactac 421 atagggcaga acgagccgga gctactggtg gcccatgcat acacccgcta catgggggat 481 ctctcggggg gccaggtgct gaagaaggtg gcccagcgag cactgaaact ccccagcaca 541 ggggaaggga cccagttcta cctgtttgag aatgtggaca atgcccagca gttcaagcag 601 ctctaccggg ccaggatgaa cgccctggac ctgaacatga agaccaaaga gaggatcgtg 661 gaggaggcca acaaggcttt tgagtataac atgcagatat tcaatgaact ggaccaggcc 721 ggctccacac tggccagaga gaccttggag gatgggttcc ctgtacacga tgggaaagga 781 gacatgcgta aatgcccttt ctacgctgct gaacaagaca aaggtgccct ggagggcagc 841 agctgtccct tccgaacagc tatggctgtg ctgaggaagc ccagcctcca gttcatcctg 901 gccgctggtg tggccctagc tgctggactc ttggcctggt actacatgta g //