LOCUS       BT019707                 819 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens insulin-like growth factor binding protein 5 mRNA,
            complete cds.
ACCESSION   BT019707
VERSION     BT019707.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 819)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 819)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..819
                     /db_xref="H-InvDB:HIT000266620"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01167X1.1"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..819
                     /note="Mutations: 818:OK"
                     /codon_start=1
                     /product="insulin-like growth factor binding protein 5"
                     /protein_id="AAV38513.1"
                     /translation="MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLG
                     CELVKEPGCGCCMTCALAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLN
                     EKSYREQVKIERDSREHEEPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKL
                     TQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPN
                     CDRKGFYKRKQCKPSRGRKRGICWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE"
BASE COUNT          169 a          269 c          255 g          126 t
ORIGIN      
        1 atggtgttgc tcaccgcggt cctcctgctg ctggccgcct atgcggggcc ggcccagagc
       61 ctgggctcct tcgtgcactg cgagccctgc gacgagaaag ccctctccat gtgccccccc
      121 agccccctgg gctgcgagct ggtcaaggag ccgggctgcg gctgctgcat gacctgcgcc
      181 ctggccgagg ggcagtcgtg cggcgtctac accgagcgct gcgcccaggg gctgcgctgc
      241 ctcccccggc aggacgagga gaagccgctg cacgccctgc tgcacggccg cggggtttgc
      301 ctcaacgaaa agagctaccg cgagcaagtc aagatcgaga gagactcccg tgagcacgag
      361 gagcccacca cctctgagat ggccgaggag acctactccc ccaagatctt ccggcccaaa
      421 cacacccgca tctccgagct gaaggctgaa gcagtgaaga aggaccgcag aaagaagctg
      481 acccagtcca agtttgtcgg gggagccgag aacactgccc acccccggat catctctgca
      541 cctgagatga gacaggagtc tgagcagggc ccctgccgca gacacatgga ggcttccctg
      601 caggagctca aagccagccc acgcatggtg ccccgtgctg tgtacctgcc caattgtgac
      661 cgcaaaggat tctacaagag aaagcagtgc aaaccttccc gtggccgcaa gcgtggcatc
      721 tgctggtgcg tggacaagta cgggatgaag ctgccaggca tggagtacgt tgacggggac
      781 tttcagtgcc acaccttcga cagcagcaac gttgagtag
//