LOCUS BT019706 819 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens insulin-like growth factor binding protein 5 mRNA, complete cds. ACCESSION BT019706 VERSION BT019706.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 819) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 819) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..819 /db_xref="H-InvDB:HIT000266619" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01167X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..819 /note="Mutations: 818:OK" /codon_start=1 /product="insulin-like growth factor binding protein 5" /protein_id="AAV38512.1" /translation="MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLG CELVKEPGCGCCMTCALAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLN EKSYREQVKIERDSREHEEPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKL TQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPN CDRKGFYKRKQCKPSRGRKRGICWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE" BASE COUNT 169 a 269 c 255 g 126 t ORIGIN 1 atggtgttgc tcaccgcggt cctcctgctg ctggccgcct atgcggggcc ggcccagagc 61 ctgggctcct tcgtgcactg cgagccctgc gacgagaaag ccctctccat gtgccccccc 121 agccccctgg gctgcgagct ggtcaaggag ccgggctgcg gctgctgcat gacctgcgcc 181 ctggccgagg ggcagtcgtg cggcgtctac accgagcgct gcgcccaggg gctgcgctgc 241 ctcccccggc aggacgagga gaagccgctg cacgccctgc tgcacggccg cggggtttgc 301 ctcaacgaaa agagctaccg cgagcaagtc aagatcgaga gagactcccg tgagcacgag 361 gagcccacca cctctgagat ggccgaggag acctactccc ccaagatctt ccggcccaaa 421 cacacccgca tctccgagct gaaggctgaa gcagtgaaga aggaccgcag aaagaagctg 481 acccagtcca agtttgtcgg gggagccgag aacactgccc acccccggat catctctgca 541 cctgagatga gacaggagtc tgagcagggc ccctgccgca gacacatgga ggcttccctg 601 caggagctca aagccagccc acgcatggtg ccccgtgctg tgtacctgcc caattgtgac 661 cgcaaaggat tctacaagag aaagcagtgc aaaccttccc gtggccgcaa gcgtggcatc 721 tgctggtgcg tggacaagta cgggatgaag ctgccaggca tggagtacgt tgacggggac 781 tttcagtgcc acaccttcga cagcagcaac gttgagtag //