LOCUS       BT019660                 540 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens transcription factor 21 mRNA, complete cds.
ACCESSION   BT019660
VERSION     BT019660.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 540)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 540)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..540
                     /db_xref="H-InvDB:HIT000266598"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01347X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..540
                     /note="Mutations: 247:T->A;539:OK"
                     /codon_start=1
                     /product="transcription factor 21"
                     /protein_id="AAV38466.1"
                     /translation="MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNC
                     ENGSPQKGRGGLGKRRKAPTKKSPLSGVSQEGKQVQRNAANARERARMRVLSKAFSRL
                     KTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKP
                     ESDLKEVVTASRLCGTTAS"
BASE COUNT          130 a          160 c          171 g           79 t
ORIGIN      
        1 atgtccaccg gctccctcag cgatgtggag gaccttcaag aggtggagat gttggaatgt
       61 gacgggttga aaatggattc gaacaaggaa tttgtgactt ccaacgagag caccgaggag
      121 agctccaact gcgagaatgg gtctccccag aagggccgcg gcggcctggg caagaggagg
      181 aaggcgccca ccaagaagag ccccctgagc ggggtcagcc aggaggggaa gcaggtccag
      241 cgcaacgccg ccaacgcgcg agagcgggcc cgcatgcgag tgctgagcaa ggccttctcc
      301 agactcaaga ccaccctgcc ctgggtgccc cccgacacca agctctccaa gctggacacg
      361 ctcaggctgg cgtccagcta catcgcccac ttgaggcaga tcctggctaa cgacaaatac
      421 gagaacgggt acattcaccc ggtcaacctg acgtggccct ttatggtggc cgggaaaccc
      481 gagagtgacc tgaaagaagt ggtgaccgcg agccgcttat gtggaaccac cgcgtcctag
//