LOCUS BT019660 540 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens transcription factor 21 mRNA, complete cds. ACCESSION BT019660 VERSION BT019660.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 540) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 540) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..540 /db_xref="H-InvDB:HIT000266598" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01347X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..540 /note="Mutations: 247:T->A;539:OK" /codon_start=1 /product="transcription factor 21" /protein_id="AAV38466.1" /translation="MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNC ENGSPQKGRGGLGKRRKAPTKKSPLSGVSQEGKQVQRNAANARERARMRVLSKAFSRL KTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKP ESDLKEVVTASRLCGTTAS" BASE COUNT 130 a 160 c 171 g 79 t ORIGIN 1 atgtccaccg gctccctcag cgatgtggag gaccttcaag aggtggagat gttggaatgt 61 gacgggttga aaatggattc gaacaaggaa tttgtgactt ccaacgagag caccgaggag 121 agctccaact gcgagaatgg gtctccccag aagggccgcg gcggcctggg caagaggagg 181 aaggcgccca ccaagaagag ccccctgagc ggggtcagcc aggaggggaa gcaggtccag 241 cgcaacgccg ccaacgcgcg agagcgggcc cgcatgcgag tgctgagcaa ggccttctcc 301 agactcaaga ccaccctgcc ctgggtgccc cccgacacca agctctccaa gctggacacg 361 ctcaggctgg cgtccagcta catcgcccac ttgaggcaga tcctggctaa cgacaaatac 421 gagaacgggt acattcaccc ggtcaacctg acgtggccct ttatggtggc cgggaaaccc 481 gagagtgacc tgaaagaagt ggtgaccgcg agccgcttat gtggaaccac cgcgtcctag //