LOCUS BT019646 906 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens syntaxin 5A mRNA, complete cds. ACCESSION BT019646 VERSION BT019646.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 906) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 906) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..906 /db_xref="H-InvDB:HIT000266588" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01341X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..906 /note="Mutations: 312:OK;822:OK;905:OK" /codon_start=1 /product="syntaxin 5A" /protein_id="AAV38452.1" /translation="MSCRDRTQEFLSACKSLQTRQNGIQTNKPALRAVRQRSEFTLMA KRIGKDLSNTFAKLEKLTILAKRKSLFDDKAVEIEELTYIIKQDINSLNKQIAQLQDF VRAKGSQSGRHLQTHSNTIVVSLQSKLASMSNDFKSVLEVRTENLKQQRSRREQFSRA PVSALPLAPNHLGGGAVVLGAESHASKDVAIDMMDSRTSQQLQLIDEQDSYIQSRADT MQNIESTIVELGSIFQQLAHMVKEQEETIQRIDENVLGAQLDVEAAHSEILKYFQSVT SNRWLMVKIFLILIVFFIIFVVFLA" BASE COUNT 230 a 248 c 230 g 198 t ORIGIN 1 atgtcctgcc gggatcggac ccaggagttt ctgtctgcct gcaagtcgct gcagacccgt 61 cagaatggaa tccagacaaa taagccagct ttgcgtgctg tccgacaacg cagtgaattc 121 accctcatgg ccaagcgcat tgggaaagac cttagcaaca catttgccaa gctggagaag 181 ctgacaatct tggcaaagcg caagtccctc tttgatgata aagcagtgga aattgaagag 241 ctaacatata tcatcaaaca ggacatcaat agcctcaaca aacaaattgc tcagctccag 301 gatttcgtga gggccaaggg cagccagagt ggccggcacc tgcagaccca ctccaacacc 361 attgtggtct ccttgcagtc gaaactggct tctatgtcca atgacttcaa atcggtttta 421 gaagtgagga cagagaacct gaagcagcag aggagccgga gagagcagtt ctcccgggca 481 cctgtgtcag ccctgcccct tgcccctaac cacctgggcg gtggtgctgt ggttctgggg 541 gcagagtccc atgcctccaa ggatgtcgcc atcgacatga tggactctcg gaccagccag 601 cagctgcagc tcattgacga gcaggattcc tacatccaga gtcgggcaga caccatgcag 661 aacattgagt cgacaattgt tgagttgggc tccatctttc agcagttggc acacatggtt 721 aaggaacagg aggaaaccat tcagaggatc gacgagaacg tgctaggagc ccagctggac 781 gttgaggccg cccattcaga gatcctcaag tacttccagt cagtcacctc caaccggtgg 841 ctcatggtca aaatcttcct catcctcatt gtcttcttca tcatctttgt ggtcttcctt 901 gcttag //