LOCUS       BT019646                 906 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens syntaxin 5A mRNA, complete cds.
ACCESSION   BT019646
VERSION     BT019646.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 906)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 906)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..906
                     /db_xref="H-InvDB:HIT000266588"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01341X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..906
                     /note="Mutations: 312:OK;822:OK;905:OK"
                     /codon_start=1
                     /product="syntaxin 5A"
                     /protein_id="AAV38452.1"
                     /translation="MSCRDRTQEFLSACKSLQTRQNGIQTNKPALRAVRQRSEFTLMA
                     KRIGKDLSNTFAKLEKLTILAKRKSLFDDKAVEIEELTYIIKQDINSLNKQIAQLQDF
                     VRAKGSQSGRHLQTHSNTIVVSLQSKLASMSNDFKSVLEVRTENLKQQRSRREQFSRA
                     PVSALPLAPNHLGGGAVVLGAESHASKDVAIDMMDSRTSQQLQLIDEQDSYIQSRADT
                     MQNIESTIVELGSIFQQLAHMVKEQEETIQRIDENVLGAQLDVEAAHSEILKYFQSVT
                     SNRWLMVKIFLILIVFFIIFVVFLA"
BASE COUNT          230 a          248 c          230 g          198 t
ORIGIN      
        1 atgtcctgcc gggatcggac ccaggagttt ctgtctgcct gcaagtcgct gcagacccgt
       61 cagaatggaa tccagacaaa taagccagct ttgcgtgctg tccgacaacg cagtgaattc
      121 accctcatgg ccaagcgcat tgggaaagac cttagcaaca catttgccaa gctggagaag
      181 ctgacaatct tggcaaagcg caagtccctc tttgatgata aagcagtgga aattgaagag
      241 ctaacatata tcatcaaaca ggacatcaat agcctcaaca aacaaattgc tcagctccag
      301 gatttcgtga gggccaaggg cagccagagt ggccggcacc tgcagaccca ctccaacacc
      361 attgtggtct ccttgcagtc gaaactggct tctatgtcca atgacttcaa atcggtttta
      421 gaagtgagga cagagaacct gaagcagcag aggagccgga gagagcagtt ctcccgggca
      481 cctgtgtcag ccctgcccct tgcccctaac cacctgggcg gtggtgctgt ggttctgggg
      541 gcagagtccc atgcctccaa ggatgtcgcc atcgacatga tggactctcg gaccagccag
      601 cagctgcagc tcattgacga gcaggattcc tacatccaga gtcgggcaga caccatgcag
      661 aacattgagt cgacaattgt tgagttgggc tccatctttc agcagttggc acacatggtt
      721 aaggaacagg aggaaaccat tcagaggatc gacgagaacg tgctaggagc ccagctggac
      781 gttgaggccg cccattcaga gatcctcaag tacttccagt cagtcacctc caaccggtgg
      841 ctcatggtca aaatcttcct catcctcatt gtcttcttca tcatctttgt ggtcttcctt
      901 gcttag
//