LOCUS BT019540 612 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens RAB7, member RAS oncogene family-like 1 mRNA, complete cds. ACCESSION BT019540 VERSION BT019540.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 612) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 612) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..612 /db_xref="H-InvDB:HIT000266544" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01397X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..612 /note="Mutations: 249:OK" /codon_start=1 /product="RAB7, member RAS oncogene family-like 1" /protein_id="AAV38347.1" /translation="MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDF ALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRW KQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENK NINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC" BASE COUNT 161 a 148 c 166 g 137 t ORIGIN 1 atgggcagcc gcgaccacct gttcaaagtg ctggtggtgg gggacgccgc agtgggcaag 61 acgtcgctgg tgcagcgata ttcccaggac agcttcagca aacactacaa gtccacggtg 121 ggagtggatt ttgctctgaa ggttctccag tggtctgact acgagatagt gcggcttcag 181 ctgtgggata ttgcagggca ggagcgcttc acctctatga cacgattgta ttatcgggat 241 gcctctgcat gtgttattat gtttgacgtt accaatgcca ctaccttcag caacagccag 301 aggtggaaac aggacctaga cagcaagctc acactaccca atggagagcc ggtgccctgc 361 ctgctcttgg ccaacaagtg tgatctgtcc ccttgggcag tgagccggga ccagattgac 421 cggttcagta aagagaacgg tttcacaggt tggacagaaa catcagtcaa ggagaacaaa 481 aatattaatg aggctatgag agtcctcatt gaaaagatga tgagaaattc cacagaagat 541 atcatgtctt tgtccaccca aggggactac atcaatctac aaaccaagtc ctccagctgg 601 tcctgctgct ag //