LOCUS       BT019540                 612 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens RAB7, member RAS oncogene family-like 1 mRNA, complete
            cds.
ACCESSION   BT019540
VERSION     BT019540.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 612)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 612)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..612
                     /db_xref="H-InvDB:HIT000266544"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01397X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..612
                     /note="Mutations: 249:OK"
                     /codon_start=1
                     /product="RAB7, member RAS oncogene family-like 1"
                     /protein_id="AAV38347.1"
                     /translation="MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDF
                     ALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRW
                     KQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENK
                     NINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC"
BASE COUNT          161 a          148 c          166 g          137 t
ORIGIN      
        1 atgggcagcc gcgaccacct gttcaaagtg ctggtggtgg gggacgccgc agtgggcaag
       61 acgtcgctgg tgcagcgata ttcccaggac agcttcagca aacactacaa gtccacggtg
      121 ggagtggatt ttgctctgaa ggttctccag tggtctgact acgagatagt gcggcttcag
      181 ctgtgggata ttgcagggca ggagcgcttc acctctatga cacgattgta ttatcgggat
      241 gcctctgcat gtgttattat gtttgacgtt accaatgcca ctaccttcag caacagccag
      301 aggtggaaac aggacctaga cagcaagctc acactaccca atggagagcc ggtgccctgc
      361 ctgctcttgg ccaacaagtg tgatctgtcc ccttgggcag tgagccggga ccagattgac
      421 cggttcagta aagagaacgg tttcacaggt tggacagaaa catcagtcaa ggagaacaaa
      481 aatattaatg aggctatgag agtcctcatt gaaaagatga tgagaaattc cacagaagat
      541 atcatgtctt tgtccaccca aggggactac atcaatctac aaaccaagtc ctccagctgg
      601 tcctgctgct ag
//