LOCUS       BT019524                1143 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens flap structure-specific endonuclease 1 mRNA, complete
            cds.
ACCESSION   BT019524
VERSION     BT019524.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1143)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1143)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..1143
                     /db_xref="H-InvDB:HIT000266534"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01409X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..1143
                     /codon_start=1
                     /product="flap structure-specific endonuclease 1"
                     /protein_id="AAV38331.1"
                     /translation="MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLI
                     AVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSE
                     RRAEAEKQLQQAQAAGAEQEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAE
                     ASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGL
                     NQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLH
                     KEAHQLFLEPEVLDPESVELKWSEPNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQG
                     STQGRLDDFFKVTGSLSSAKRKEPEPKGSTKKKAKTGAAGKFKRGK"
BASE COUNT          290 a          283 c          354 g          216 t
ORIGIN      
        1 atgggaattc aaggcctggc caaactaatt gctgatgtgg cccccagtgc catccgggag
       61 aatgacatca agagctactt tggccgtaag gtggccattg atgcctctat gagcatttat
      121 cagttcctga ttgctgttcg ccagggtggg gatgtgctgc agaatgagga gggtgagacc
      181 accagccacc tgatgggcat gttctaccgc accattcgca tgatggagaa cggcatcaag
      241 cccgtgtatg tctttgatgg caagccgcca cagctcaagt caggcgagct ggccaaacgc
      301 agtgagcggc gggctgaggc agagaagcag ctgcagcagg ctcaggctgc tggggccgag
      361 caggaggtgg aaaaattcac taagcggctg gtgaaggtca ctaagcagca caatgatgag
      421 tgcaaacatc tgctgagcct catgggcatc ccttatcttg atgcacccag tgaggcagag
      481 gccagctgtg ctgccctggt gaaggctggc aaagtctatg ctgcggctac cgaggacatg
      541 gactgcctca ccttcggcag ccctgtgcta atgcgacacc tgactgccag tgaagccaaa
      601 aagctgccaa tccaggaatt ccacctgagc cggattctgc aggagctggg cctgaaccag
      661 gaacagtttg tggatctgtg catcctgcta ggcagtgact actgtgagag tatccggggt
      721 attgggccca agcgggctgt ggacctcatc cagaagcaca agagcatcga ggagatcgtg
      781 cggcgacttg accccaacaa gtaccctgtg ccagaaaatt ggctccacaa ggaggctcac
      841 cagctcttct tggaacctga ggtgctggac ccagagtctg tggagctgaa gtggagcgag
      901 ccaaatgaag aagagctgat caagttcatg tgtggtgaaa agcagttctc tgaggagcga
      961 atccgcagtg gggtcaagag gctgagtaag agccgccaag gcagcaccca gggccgcctg
     1021 gatgatttct tcaaggtgac cggctcactc tcttcagcta agcgcaagga gccagaaccc
     1081 aagggatcca ctaagaagaa ggcaaagact ggggcagcag ggaagtttaa aaggggaaaa
     1141 tag
//