LOCUS BT019524 1143 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens flap structure-specific endonuclease 1 mRNA, complete cds. ACCESSION BT019524 VERSION BT019524.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1143) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 1143) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..1143 /db_xref="H-InvDB:HIT000266534" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01409X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..1143 /codon_start=1 /product="flap structure-specific endonuclease 1" /protein_id="AAV38331.1" /translation="MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLI AVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSE RRAEAEKQLQQAQAAGAEQEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAE ASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGL NQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLH KEAHQLFLEPEVLDPESVELKWSEPNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQG STQGRLDDFFKVTGSLSSAKRKEPEPKGSTKKKAKTGAAGKFKRGK" BASE COUNT 290 a 283 c 354 g 216 t ORIGIN 1 atgggaattc aaggcctggc caaactaatt gctgatgtgg cccccagtgc catccgggag 61 aatgacatca agagctactt tggccgtaag gtggccattg atgcctctat gagcatttat 121 cagttcctga ttgctgttcg ccagggtggg gatgtgctgc agaatgagga gggtgagacc 181 accagccacc tgatgggcat gttctaccgc accattcgca tgatggagaa cggcatcaag 241 cccgtgtatg tctttgatgg caagccgcca cagctcaagt caggcgagct ggccaaacgc 301 agtgagcggc gggctgaggc agagaagcag ctgcagcagg ctcaggctgc tggggccgag 361 caggaggtgg aaaaattcac taagcggctg gtgaaggtca ctaagcagca caatgatgag 421 tgcaaacatc tgctgagcct catgggcatc ccttatcttg atgcacccag tgaggcagag 481 gccagctgtg ctgccctggt gaaggctggc aaagtctatg ctgcggctac cgaggacatg 541 gactgcctca ccttcggcag ccctgtgcta atgcgacacc tgactgccag tgaagccaaa 601 aagctgccaa tccaggaatt ccacctgagc cggattctgc aggagctggg cctgaaccag 661 gaacagtttg tggatctgtg catcctgcta ggcagtgact actgtgagag tatccggggt 721 attgggccca agcgggctgt ggacctcatc cagaagcaca agagcatcga ggagatcgtg 781 cggcgacttg accccaacaa gtaccctgtg ccagaaaatt ggctccacaa ggaggctcac 841 cagctcttct tggaacctga ggtgctggac ccagagtctg tggagctgaa gtggagcgag 901 ccaaatgaag aagagctgat caagttcatg tgtggtgaaa agcagttctc tgaggagcga 961 atccgcagtg gggtcaagag gctgagtaag agccgccaag gcagcaccca gggccgcctg 1021 gatgatttct tcaaggtgac cggctcactc tcttcagcta agcgcaagga gccagaaccc 1081 aagggatcca ctaagaagaa ggcaaagact ggggcagcag ggaagtttaa aaggggaaaa 1141 tag //