LOCUS BT019518 822 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens xeroderma pigmentosum, complementation group A mRNA, complete cds. ACCESSION BT019518 VERSION BT019518.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 822) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 822) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..822 /db_xref="H-InvDB:HIT000266530" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01155X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..822 /note="Mutations: 821:OK" /codon_start=1 /product="xeroderma pigmentosum, complementation group A" /protein_id="AAV38325.1" /translation="MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLA ARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDY VICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREP PLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKK FDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM" BASE COUNT 280 a 144 c 225 g 173 t ORIGIN 1 atggcggcgg ccgacggggc tttgccggag gcggcggctt tagagcaacc cgcggagctg 61 cctgcctcgg tgcgggcgag tatcgagcgg aagcggcagc gggcactgat gctgcgccag 121 gcccggctgg ctgcccggcc ctactcggcg acggcggctg cggctactgg aggcatggct 181 aatgtaaaag cagccccaaa gataattgac acaggaggag gcttcatttt agaagaggaa 241 gaagaagaag aacagaaaat tggaaaagtt gttcatcaac caggacctgt tatggaattt 301 gattatgtaa tatgcgaaga atgtgggaaa gaatttatgg attcttatct tatgaaccac 361 tttgatttgc caacttgtga taactgcaga gatgctgatg ataaacacaa gcttataacc 421 aaaacagagg caaaacaaga atatcttctg aaagactgtg atttagaaaa aagagagcca 481 cctcttaaat ttattgtgaa gaagaatcca catcattcac aatggggtga tatgaaactc 541 tacttaaagt tacagattgt gaagaggtct cttgaagttt ggggtagtca agaagcatta 601 gaagaagcaa aggaagtccg acaggaaaac cgagaaaaaa tgaaacagaa gaaatttgat 661 aaaaaagtaa aagaattgcg gcgagcagta agaagcagcg tgtggaaaag ggagacgatt 721 gttcatcaac atgagtatgg accagaagaa aacctagaag atgacatgta ccgtaagact 781 tgtactatgt gtggccatga actgacatat gaaaaaatgt ag //