LOCUS       BT019518                 822 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens xeroderma pigmentosum, complementation group A mRNA,
            complete cds.
ACCESSION   BT019518
VERSION     BT019518.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 822)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 822)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..822
                     /db_xref="H-InvDB:HIT000266530"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01155X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..822
                     /note="Mutations: 821:OK"
                     /codon_start=1
                     /product="xeroderma pigmentosum, complementation group A"
                     /protein_id="AAV38325.1"
                     /translation="MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLA
                     ARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDY
                     VICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREP
                     PLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKK
                     FDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM"
BASE COUNT          280 a          144 c          225 g          173 t
ORIGIN      
        1 atggcggcgg ccgacggggc tttgccggag gcggcggctt tagagcaacc cgcggagctg
       61 cctgcctcgg tgcgggcgag tatcgagcgg aagcggcagc gggcactgat gctgcgccag
      121 gcccggctgg ctgcccggcc ctactcggcg acggcggctg cggctactgg aggcatggct
      181 aatgtaaaag cagccccaaa gataattgac acaggaggag gcttcatttt agaagaggaa
      241 gaagaagaag aacagaaaat tggaaaagtt gttcatcaac caggacctgt tatggaattt
      301 gattatgtaa tatgcgaaga atgtgggaaa gaatttatgg attcttatct tatgaaccac
      361 tttgatttgc caacttgtga taactgcaga gatgctgatg ataaacacaa gcttataacc
      421 aaaacagagg caaaacaaga atatcttctg aaagactgtg atttagaaaa aagagagcca
      481 cctcttaaat ttattgtgaa gaagaatcca catcattcac aatggggtga tatgaaactc
      541 tacttaaagt tacagattgt gaagaggtct cttgaagttt ggggtagtca agaagcatta
      601 gaagaagcaa aggaagtccg acaggaaaac cgagaaaaaa tgaaacagaa gaaatttgat
      661 aaaaaagtaa aagaattgcg gcgagcagta agaagcagcg tgtggaaaag ggagacgatt
      721 gttcatcaac atgagtatgg accagaagaa aacctagaag atgacatgta ccgtaagact
      781 tgtactatgt gtggccatga actgacatat gaaaaaatgt ag
//