LOCUS       BT019438                 564 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens non-metastatic cells 4, protein expressed in mRNA,
            complete cds.
ACCESSION   BT019438
VERSION     BT019438.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 564)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 564)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..564
                     /db_xref="H-InvDB:HIT000266493"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01446X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..564
                     /note="Mutations: 531:OK;563:OK"
                     /codon_start=1
                     /product="non-metastatic cells 4, protein expressed in"
                     /protein_id="AAV38245.1"
                     /translation="MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAV
                     KPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMS
                     SGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQ
                     REIQLWFQSSELVSWADGGQHSSIHPA"
BASE COUNT           94 a          175 c          205 g           90 t
ORIGIN      
        1 atgggcggcc tcttctggcg ctccgcgctg cgggggctgc gctgcggccc gcgggccccg
       61 ggcccgagcc tgctagtgcg ccacggctcg ggagggccct cctggacccg ggagcggacc
      121 ctggtggcgg tgaagcccga tggcgtgcaa cggcggctcg ttggggacgt gatccagcgc
      181 tttgagaggc ggggcttcac gctggtgggg atgaagatgc tgcaggcacc agagagcgtc
      241 cttgccgagc actaccagga cctgcggagg aagcccttct accctgccct catccgctac
      301 atgagctctg ggcctgtggt ggccatggtc tgggaagggt acaatgtcgt ccgcgcctca
      361 agggccatga ttggacacac cgactcggct gaggctgccc caggaaccat aaggggtgac
      421 ttcagcgtcc acatcagcag gaatgtcatc cacgccagcg actccgtgga gggggcccag
      481 cgggagatcc agctgtggtt ccagagcagt gagctggtga gctgggcaga tgggggccag
      541 cacagcagca tccacccagc ctag
//