LOCUS BT019438 564 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens non-metastatic cells 4, protein expressed in mRNA, complete cds. ACCESSION BT019438 VERSION BT019438.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 564) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 564) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..564 /db_xref="H-InvDB:HIT000266493" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01446X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..564 /note="Mutations: 531:OK;563:OK" /codon_start=1 /product="non-metastatic cells 4, protein expressed in" /protein_id="AAV38245.1" /translation="MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAV KPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMS SGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQ REIQLWFQSSELVSWADGGQHSSIHPA" BASE COUNT 94 a 175 c 205 g 90 t ORIGIN 1 atgggcggcc tcttctggcg ctccgcgctg cgggggctgc gctgcggccc gcgggccccg 61 ggcccgagcc tgctagtgcg ccacggctcg ggagggccct cctggacccg ggagcggacc 121 ctggtggcgg tgaagcccga tggcgtgcaa cggcggctcg ttggggacgt gatccagcgc 181 tttgagaggc ggggcttcac gctggtgggg atgaagatgc tgcaggcacc agagagcgtc 241 cttgccgagc actaccagga cctgcggagg aagcccttct accctgccct catccgctac 301 atgagctctg ggcctgtggt ggccatggtc tgggaagggt acaatgtcgt ccgcgcctca 361 agggccatga ttggacacac cgactcggct gaggctgccc caggaaccat aaggggtgac 421 ttcagcgtcc acatcagcag gaatgtcatc cacgccagcg actccgtgga gggggcccag 481 cgggagatcc agctgtggtt ccagagcagt gagctggtga gctgggcaga tgggggccag 541 cacagcagca tccacccagc ctag //