LOCUS       BT019423                 543 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens neuroblastoma, suppression of tumorigenicity 1 mRNA,
            complete cds.
ACCESSION   BT019423
VERSION     BT019423.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 543)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 543)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..543
                     /db_xref="H-InvDB:HIT000266488"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01461X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..543
                     /codon_start=1
                     /product="neuroblastoma, suppression of tumorigenicity 1"
                     /protein_id="AAV38230.1"
                     /translation="MLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVG
                     HSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHE
                     EVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQ
                     TPEPEDPPGAPHTEEEGAED"
BASE COUNT          108 a          185 c          167 g           83 t
ORIGIN      
        1 atgcttcggg tcctggtggg ggctgtcctc cctgccatgc tactggctgc cccaccaccc
       61 atcaacaagc tggcactgtt cccagataag agtgcctggt gcgaagccaa gaacatcacc
      121 cagatcgtgg gccacagcgg ctgtgaggcc aagtccatcc agaacagggc gtgcctagga
      181 cagtgcttca gctacagcgt ccccaacacc ttcccacagt ccacagagtc cctggttcac
      241 tgtgactcct gcatgccagc ccagtccatg tgggagattg tgacgctgga gtgcccgggc
      301 cacgaggagg tgcccagggt ggacaagctg gtggagaaga tcctgcactg tagctgccag
      361 gcctgcggca aggagcctag tcacgagggg ctgagcgtct atgtgcaggg cgaggacggg
      421 ccgggatccc agcccggcac ccaccctcac ccccatcccc acccccatcc tggcgggcag
      481 acccctgagc ccgaggaccc ccctggggcc ccccacacag aggaagaggg ggctgaggac
      541 tag
//