LOCUS BT019423 543 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens neuroblastoma, suppression of tumorigenicity 1 mRNA, complete cds. ACCESSION BT019423 VERSION BT019423.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 543) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 543) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..543 /db_xref="H-InvDB:HIT000266488" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01461X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..543 /codon_start=1 /product="neuroblastoma, suppression of tumorigenicity 1" /protein_id="AAV38230.1" /translation="MLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVG HSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHE EVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQ TPEPEDPPGAPHTEEEGAED" BASE COUNT 108 a 185 c 167 g 83 t ORIGIN 1 atgcttcggg tcctggtggg ggctgtcctc cctgccatgc tactggctgc cccaccaccc 61 atcaacaagc tggcactgtt cccagataag agtgcctggt gcgaagccaa gaacatcacc 121 cagatcgtgg gccacagcgg ctgtgaggcc aagtccatcc agaacagggc gtgcctagga 181 cagtgcttca gctacagcgt ccccaacacc ttcccacagt ccacagagtc cctggttcac 241 tgtgactcct gcatgccagc ccagtccatg tgggagattg tgacgctgga gtgcccgggc 301 cacgaggagg tgcccagggt ggacaagctg gtggagaaga tcctgcactg tagctgccag 361 gcctgcggca aggagcctag tcacgagggg ctgagcgtct atgtgcaggg cgaggacggg 421 ccgggatccc agcccggcac ccaccctcac ccccatcccc acccccatcc tggcgggcag 481 acccctgagc ccgaggaccc ccctggggcc ccccacacag aggaagaggg ggctgaggac 541 tag //