LOCUS       BT019390                 678 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens breast carcinoma amplified sequence 2 mRNA, complete
            cds.
ACCESSION   BT019390
VERSION     BT019390.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 678)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 678)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..678
                     /db_xref="H-InvDB:HIT000266474"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01487X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..678
                     /note="Mutations: 677:OK"
                     /codon_start=1
                     /product="breast carcinoma amplified sequence 2"
                     /protein_id="AAV38197.1"
                     /translation="MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYR
                     PTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITA
                     WQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHI
                     QDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANK
                     ENIRQDF"
BASE COUNT          229 a          126 c          166 g          157 t
ORIGIN      
        1 atggcgggca caggtttggt ggctggagag gttgtggtgg atgcgctgcc gtattttgat
       61 caaggttatg aagcccctgg tgtgcgggaa gcggctgcag cgctggtgga ggaggaaact
      121 cgcagatacc gacctactaa gaactacctg agctacctga cagccccgga ttattctgcc
      181 tttgaaactg acataatgag aaatgaattt gaaagactgg ctgctcgaca accaattgaa
      241 ttgctcagta tgaaacgata tgagcttcca gccccctcct ctggtcaaaa aaatgacatt
      301 actgcatggc aagaatgtgt aaacaattct atggcccagt tagagcatca agcagttaga
      361 attgagaatc tggaactaat gtcacagcat ggatgtaatg cctggaaagt atacaatgaa
      421 aatctagttc atatgattga acacgcacag aaggaacttc agaagttaag aaaacatatt
      481 caagatttaa actggcagag aaagaacatg caactcacag ctggatctaa attgagagaa
      541 atggagtcaa attgggtatc cctggtcagt aagaattatg agattgaacg gactattgtt
      601 cagctagaaa atgaaatcta tcaaattaag cagcaacatg gagaggcaaa caaagaaaac
      661 atccggcaag acttctag
//