LOCUS BT019390 678 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens breast carcinoma amplified sequence 2 mRNA, complete cds. ACCESSION BT019390 VERSION BT019390.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 678) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 678) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..678 /db_xref="H-InvDB:HIT000266474" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01487X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..678 /note="Mutations: 677:OK" /codon_start=1 /product="breast carcinoma amplified sequence 2" /protein_id="AAV38197.1" /translation="MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYR PTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITA WQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHI QDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANK ENIRQDF" BASE COUNT 229 a 126 c 166 g 157 t ORIGIN 1 atggcgggca caggtttggt ggctggagag gttgtggtgg atgcgctgcc gtattttgat 61 caaggttatg aagcccctgg tgtgcgggaa gcggctgcag cgctggtgga ggaggaaact 121 cgcagatacc gacctactaa gaactacctg agctacctga cagccccgga ttattctgcc 181 tttgaaactg acataatgag aaatgaattt gaaagactgg ctgctcgaca accaattgaa 241 ttgctcagta tgaaacgata tgagcttcca gccccctcct ctggtcaaaa aaatgacatt 301 actgcatggc aagaatgtgt aaacaattct atggcccagt tagagcatca agcagttaga 361 attgagaatc tggaactaat gtcacagcat ggatgtaatg cctggaaagt atacaatgaa 421 aatctagttc atatgattga acacgcacag aaggaacttc agaagttaag aaaacatatt 481 caagatttaa actggcagag aaagaacatg caactcacag ctggatctaa attgagagaa 541 atggagtcaa attgggtatc cctggtcagt aagaattatg agattgaacg gactattgtt 601 cagctagaaa atgaaatcta tcaaattaag cagcaacatg gagaggcaaa caaagaaaac 661 atccggcaag acttctag //