LOCUS       BT019348                 699 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens vesicle transport through interaction with t-SNAREs
            homolog 1B (yeast) mRNA, complete cds.
ACCESSION   BT019348
VERSION     BT019348.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 699)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 699)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..699
                     /db_xref="H-InvDB:HIT000266456"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01508X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..699
                     /note="Mutations: 698:OK"
                     /codon_start=1
                     /product="vesicle transport through interaction with
                     t-SNAREs homolog 1B (yeast)"
                     /protein_id="AAV38155.1"
                     /translation="MASSAASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKL
                     IRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRNYRKDLAKLHREVRSTPLTA
                     TPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLNRATQSIERSHRIATETDQIG
                     SEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLSIIILLELA
                     ILGGLVYYKFFRSH"
BASE COUNT          209 a          169 c          184 g          137 t
ORIGIN      
        1 atggcctcct ccgccgcctc ctcggagcat ttcgagaagc tgcacgagat cttccgcggc
       61 ctccatgaag acctacaagg ggtgcccgag cggctgctgg ggacggcggg gaccgaagaa
      121 aagaagaaat tgatcaggga ttttgatgaa aagcaacagg aagcaaatga aacgctggca
      181 gagatggagg aggagctacg ttatgcaccc ctgtctttcc gaaaccccat gatgtctaag
      241 cttcgaaact accggaagga ccttgctaaa ctccatcggg aggtgagaag cacacctttg
      301 acagccacac ctggaggccg aggagacatg aaatatggca tatatgctgt agagaatgag
      361 catatgaatc ggctacagtc tcaaagggca atgcttctgc agggcactga aagcctgaac
      421 cgggccaccc aaagtattga acgttctcat cggattgcca cagagactga ccagattggc
      481 tcagaaatca tagaagagct gggggaacaa cgagaccagt tagaacgtac caagagtaga
      541 ctggtaaaca caagtgaaaa cttgagcaaa agtcggaaga ttctccgttc aatgtccaga
      601 aaagtgacaa ccaacaagct gctgctttcc attatcatct tactggagct cgccatcctg
      661 ggaggcctgg tttactacaa attctttcgc agccattag
//