LOCUS BT019348 699 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens vesicle transport through interaction with t-SNAREs homolog 1B (yeast) mRNA, complete cds. ACCESSION BT019348 VERSION BT019348.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 699) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 699) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..699 /db_xref="H-InvDB:HIT000266456" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01508X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..699 /note="Mutations: 698:OK" /codon_start=1 /product="vesicle transport through interaction with t-SNAREs homolog 1B (yeast)" /protein_id="AAV38155.1" /translation="MASSAASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKL IRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRNYRKDLAKLHREVRSTPLTA TPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLNRATQSIERSHRIATETDQIG SEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLSIIILLELA ILGGLVYYKFFRSH" BASE COUNT 209 a 169 c 184 g 137 t ORIGIN 1 atggcctcct ccgccgcctc ctcggagcat ttcgagaagc tgcacgagat cttccgcggc 61 ctccatgaag acctacaagg ggtgcccgag cggctgctgg ggacggcggg gaccgaagaa 121 aagaagaaat tgatcaggga ttttgatgaa aagcaacagg aagcaaatga aacgctggca 181 gagatggagg aggagctacg ttatgcaccc ctgtctttcc gaaaccccat gatgtctaag 241 cttcgaaact accggaagga ccttgctaaa ctccatcggg aggtgagaag cacacctttg 301 acagccacac ctggaggccg aggagacatg aaatatggca tatatgctgt agagaatgag 361 catatgaatc ggctacagtc tcaaagggca atgcttctgc agggcactga aagcctgaac 421 cgggccaccc aaagtattga acgttctcat cggattgcca cagagactga ccagattggc 481 tcagaaatca tagaagagct gggggaacaa cgagaccagt tagaacgtac caagagtaga 541 ctggtaaaca caagtgaaaa cttgagcaaa agtcggaaga ttctccgttc aatgtccaga 601 aaagtgacaa ccaacaagct gctgctttcc attatcatct tactggagct cgccatcctg 661 ggaggcctgg tttactacaa attctttcgc agccattag //