LOCUS BT019331 492 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1 mRNA, complete cds. ACCESSION BT019331 VERSION BT019331.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 492) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 492) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..492 /db_xref="H-InvDB:HIT000266449" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01501X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..492 /note="Mutations: 491:OK" /codon_start=1 /product="protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1" /protein_id="AAV38138.1" /translation="MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSG GKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEED FESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIIL RTE" BASE COUNT 111 a 143 c 167 g 71 t ORIGIN 1 atggcggacg aggagaagct gccgcccggc tgggagaagc gcatgagccg cagctcaggc 61 cgagtgtact acttcaacca catcactaac gccagccagt gggagcggcc cagcggcaac 121 agcagcagtg gtggcaaaaa cgggcagggg gagcctgcca gggtccgctg ctcgcacctg 181 ctggtgaagc acagccagtc acggcggccc tcgtcctggc ggcaggagaa gatcacccgg 241 accaaggagg aggccctgga gctgatcaac ggctacatcc agaagatcaa gtcgggagag 301 gaggactttg agtctctggc ctcacagttc agcgactgca gctcagccaa ggccagggga 361 gacctgggtg ccttcagcag aggtcagatg cagaagccat ttgaagacgc ctcgtttgcg 421 ctgcggacgg gggagatgag cgggcccgtg ttcacggatt ccggcatcca catcatcctc 481 cgcactgagt ag //