LOCUS       BT019331                 492 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens protein (peptidyl-prolyl cis/trans isomerase)
            NIMA-interacting 1 mRNA, complete cds.
ACCESSION   BT019331
VERSION     BT019331.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 492)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 492)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..492
                     /db_xref="H-InvDB:HIT000266449"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01501X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..492
                     /note="Mutations: 491:OK"
                     /codon_start=1
                     /product="protein (peptidyl-prolyl cis/trans isomerase)
                     NIMA-interacting 1"
                     /protein_id="AAV38138.1"
                     /translation="MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSG
                     GKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEED
                     FESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIIL
                     RTE"
BASE COUNT          111 a          143 c          167 g           71 t
ORIGIN      
        1 atggcggacg aggagaagct gccgcccggc tgggagaagc gcatgagccg cagctcaggc
       61 cgagtgtact acttcaacca catcactaac gccagccagt gggagcggcc cagcggcaac
      121 agcagcagtg gtggcaaaaa cgggcagggg gagcctgcca gggtccgctg ctcgcacctg
      181 ctggtgaagc acagccagtc acggcggccc tcgtcctggc ggcaggagaa gatcacccgg
      241 accaaggagg aggccctgga gctgatcaac ggctacatcc agaagatcaa gtcgggagag
      301 gaggactttg agtctctggc ctcacagttc agcgactgca gctcagccaa ggccagggga
      361 gacctgggtg ccttcagcag aggtcagatg cagaagccat ttgaagacgc ctcgtttgcg
      421 ctgcggacgg gggagatgag cgggcccgtg ttcacggatt ccggcatcca catcatcctc
      481 cgcactgagt ag
//