LOCUS       BT019329                 852 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens gap junction protein, beta 1, 32kDa (connexin 32,
            Charcot-Marie-Tooth neuropathy, X-linked) mRNA, complete cds.
ACCESSION   BT019329
VERSION     BT019329.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 852)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 852)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..852
                     /db_xref="H-InvDB:HIT000266448"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01144X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..852
                     /note="Mutations: 696:OK;851:OK"
                     /codon_start=1
                     /product="gap junction protein, beta 1, 32kDa (connexin
                     32, Charcot-Marie-Tooth neuropathy, X-linked)"
                     /protein_id="AAV38136.1"
                     /translation="MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVW
                     GDEKSSFICNTLQPGCNSVCYDQFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIE
                     KKMLRLEGHGDPLHLEEVKRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGY
                     AMVRLVKCDVYPCPNTVDCFVSRPTEKTVFTVFMLAASGICIILNVAEVVYLIIRACA
                     RRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEK
                     SDRCSAC"
BASE COUNT          164 a          262 c          229 g          197 t
ORIGIN      
        1 atgaactgga caggtttgta caccttgctc agtggcgtga accggcattc tactgccatt
       61 ggccgagtat ggctctcggt catcttcatc ttcagaatca tggtgctggt ggtggctgca
      121 gagagtgtgt ggggtgatga gaaatcttcc ttcatctgca acacactcca gcctggctgc
      181 aacagcgttt gctatgacca attcttcccc atctcccatg tgcggctgtg gtccctgcag
      241 ctcatcctag tttccacccc agctctcctc gtggccatgc acgtggctca ccagcaacac
      301 atagagaaga aaatgctacg gcttgagggc catggggacc ccctacacct ggaggaggtg
      361 aagaggcaca aggtccacat ctcagggaca ctgtggtgga cctatgtcat cagcgtggtg
      421 ttccggctgt tgtttgaggc cgtcttcatg tatgtctttt atctgctcta ccctggctat
      481 gccatggtgc ggctggtcaa gtgcgacgtc tacccctgcc ccaacacagt ggactgcttc
      541 gtgtcccgcc ccaccgagaa aaccgtcttc accgtcttca tgctagctgc ctctggcatc
      601 tgcatcatcc tcaatgtggc cgaggtggtg tacctcatca tccgggcctg tgcccgccga
      661 gcccagcgcc gctccaatcc accttcccgc aagggttcgg gcttcggcca ccgcctctca
      721 cctgaataca agcagaatga gatcaacaag ctgctgagtg agcaggatgg ctccctgaaa
      781 gacatactgc gccgcagccc tggcaccggg gctgggctgg ctgaaaagag cgaccgctgc
      841 tcggcctgct ag
//