LOCUS BT019329 852 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens gap junction protein, beta 1, 32kDa (connexin 32, Charcot-Marie-Tooth neuropathy, X-linked) mRNA, complete cds. ACCESSION BT019329 VERSION BT019329.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 852) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 852) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..852 /db_xref="H-InvDB:HIT000266448" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01144X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..852 /note="Mutations: 696:OK;851:OK" /codon_start=1 /product="gap junction protein, beta 1, 32kDa (connexin 32, Charcot-Marie-Tooth neuropathy, X-linked)" /protein_id="AAV38136.1" /translation="MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVW GDEKSSFICNTLQPGCNSVCYDQFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIE KKMLRLEGHGDPLHLEEVKRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGY AMVRLVKCDVYPCPNTVDCFVSRPTEKTVFTVFMLAASGICIILNVAEVVYLIIRACA RRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEK SDRCSAC" BASE COUNT 164 a 262 c 229 g 197 t ORIGIN 1 atgaactgga caggtttgta caccttgctc agtggcgtga accggcattc tactgccatt 61 ggccgagtat ggctctcggt catcttcatc ttcagaatca tggtgctggt ggtggctgca 121 gagagtgtgt ggggtgatga gaaatcttcc ttcatctgca acacactcca gcctggctgc 181 aacagcgttt gctatgacca attcttcccc atctcccatg tgcggctgtg gtccctgcag 241 ctcatcctag tttccacccc agctctcctc gtggccatgc acgtggctca ccagcaacac 301 atagagaaga aaatgctacg gcttgagggc catggggacc ccctacacct ggaggaggtg 361 aagaggcaca aggtccacat ctcagggaca ctgtggtgga cctatgtcat cagcgtggtg 421 ttccggctgt tgtttgaggc cgtcttcatg tatgtctttt atctgctcta ccctggctat 481 gccatggtgc ggctggtcaa gtgcgacgtc tacccctgcc ccaacacagt ggactgcttc 541 gtgtcccgcc ccaccgagaa aaccgtcttc accgtcttca tgctagctgc ctctggcatc 601 tgcatcatcc tcaatgtggc cgaggtggtg tacctcatca tccgggcctg tgcccgccga 661 gcccagcgcc gctccaatcc accttcccgc aagggttcgg gcttcggcca ccgcctctca 721 cctgaataca agcagaatga gatcaacaag ctgctgagtg agcaggatgg ctccctgaaa 781 gacatactgc gccgcagccc tggcaccggg gctgggctgg ctgaaaagag cgaccgctgc 841 tcggcctgct ag //