LOCUS BT009857 387 bp mRNA linear HUM 02-AUG-2003 DEFINITION Homo sapiens mitochondrial ribosomal protein L28 mRNA, complete cds. ACCESSION BT009857 VERSION BT009857.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 387) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (17-JUL-2003) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA REFERENCE 2 (bases 1 to 387) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (02-AUG-2003) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..387 /db_xref="H-InvDB:HIT000266419" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01071X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..387 /codon_start=1 /product="mitochondrial ribosomal protein L28" /protein_id="AAP88859.1" /translation="MRTLDLIDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQ DPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIY VAELIQQLQQQALSEPAVVQKRASGQ" BASE COUNT 88 a 105 c 131 g 63 t ORIGIN 1 atgcggaccc tggacctcat cgatgaggct tacgggctcg acttttacat cctcaagacc 61 ccgaaggagg acctgtgctc caagtttggg atggacctga agcgagggat gctgctgcgg 121 cttgcccggc aggaccccca gctgcacccc gaggaccccg agcggcgggc agccatctac 181 gacaagtaca aggaatttgc catcccagag gaggaggcag agtgggtggg cctcacgctg 241 gaggaggcca ttgagaagca gagacttttg gaggagaagg accctgtacc cctgttcaag 301 atctatgtgg cggagctgat ccagcagctg cagcagcagg cactgtcaga gccggcggtg 361 gtgcagaaga gagccagtgg ccagtag //