LOCUS BT009851 342 bp mRNA linear HUM 02-AUG-2003 DEFINITION Homo sapiens TYRO protein tyrosine kinase binding protein mRNA, complete cds. ACCESSION BT009851 VERSION BT009851.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 342) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (17-JUL-2003) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA REFERENCE 2 (bases 1 to 342) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (02-AUG-2003) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..342 /db_xref="H-InvDB:HIT000266413" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01065X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..342 /codon_start=1 /product="TYRO protein tyrosine kinase binding protein" /protein_id="AAP88853.1" /translation="MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLA GIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVY SDLNTQRPYYK" BASE COUNT 60 a 100 c 115 g 67 t ORIGIN 1 atggggggac ttgaaccctg cagcaggctc ctgctcctgc ctctcctgct ggctgtaagt 61 ggtctccgtc ctgtccaggc ccaggcccag agcgattgca gttgctctac ggtgagcccg 121 ggcgtgctgg cagggatcgt gatgggagac ctggtgctga cagtgctcat tgccctggcc 181 gtgtacttcc tgggccggct ggtccctcgg gggcgagggg ctgcggaggc agcgacccgg 241 aaacagcgta tcactgagac cgagtcgcct tatcaggagc tccagggtca gaggtcggat 301 gtctacagcg acctcaacac acagaggccg tattacaaat ag //