LOCUS BT009847 318 bp mRNA linear HUM 02-AUG-2003 DEFINITION Homo sapiens dynein, axonemal, light polypeptide 4 mRNA, complete cds. ACCESSION BT009847 VERSION BT009847.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 318) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (17-JUL-2003) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA REFERENCE 2 (bases 1 to 318) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (02-AUG-2003) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..318 /db_xref="H-InvDB:HIT000266409" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01061X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..318 /codon_start=1 /product="dynein, axonemal, light polypeptide 4" /protein_id="AAP88849.1" /translation="MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACE KFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVW KCS" BASE COUNT 83 a 77 c 98 g 60 t ORIGIN 1 atgggagaaa cagaagggaa gaaagatgag gctgactata agcgactgca gaccttccct 61 ctggtcaggc actcggacat gccagaggag atgcgcgtgg agaccatgga gctatgtgtc 121 acagcctgtg agaaattctc caacaacaac gagagcgccg ccaagatgat caaagagaca 181 atggacaaga agttcggctc ctcctggcac gtggtgatcg gcgagggctt tgggtttgag 241 atcacccacg aggtgaagaa cctcctctac ctgtacttcg ggggcaccct ggctgtgtgc 301 gtctggaagt gctcctag //