LOCUS       BT009847                 318 bp    mRNA    linear   HUM 02-AUG-2003
DEFINITION  Homo sapiens dynein, axonemal, light polypeptide 4 mRNA, complete
            cds.
ACCESSION   BT009847
VERSION     BT009847.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 318)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-JUL-2003) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
REFERENCE   2  (bases 1 to 318)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-AUG-2003) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..318
                     /db_xref="H-InvDB:HIT000266409"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01061X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..318
                     /codon_start=1
                     /product="dynein, axonemal, light polypeptide 4"
                     /protein_id="AAP88849.1"
                     /translation="MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACE
                     KFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVW
                     KCS"
BASE COUNT           83 a           77 c           98 g           60 t
ORIGIN      
        1 atgggagaaa cagaagggaa gaaagatgag gctgactata agcgactgca gaccttccct
       61 ctggtcaggc actcggacat gccagaggag atgcgcgtgg agaccatgga gctatgtgtc
      121 acagcctgtg agaaattctc caacaacaac gagagcgccg ccaagatgat caaagagaca
      181 atggacaaga agttcggctc ctcctggcac gtggtgatcg gcgagggctt tgggtttgag
      241 atcacccacg aggtgaagaa cctcctctac ctgtacttcg ggggcaccct ggctgtgtgc
      301 gtctggaagt gctcctag
//