LOCUS BT009845 273 bp mRNA linear HUM 02-AUG-2003 DEFINITION Homo sapiens TP53 target gene 1 mRNA, complete cds. ACCESSION BT009845 VERSION BT009845.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 273) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (17-JUL-2003) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA REFERENCE 2 (bases 1 to 273) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (02-AUG-2003) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..273 /db_xref="H-InvDB:HIT000266407" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01059X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..273 /codon_start=1 /product="TP53 target gene 1" /protein_id="AAP88847.1" /translation="MMLGSLAPDPGSRRHSGQAALRPRRYPTLWDRCRKRWLRPIFTQ LLAAGLAYHTLLPIPSEPLFAAPGEHLHQCFVKESYCPPRVLAKEQ" BASE COUNT 62 a 85 c 68 g 58 t ORIGIN 1 atgatgctgg ggagcttggc gcctgaccca ggatctagaa ggcactctgg gcaggccgcg 61 ctccgcccac gaaggtaccc aaccctctgg gatagatgca ggaagcgatg gttaagaccc 121 attttcaccc aacttctcgc cgcaggtctg gcttaccaca cgctcctccc cattcccagt 181 gagccgcttt ttgcagcacc aggcgaacac ttacaccagt gctttgtaaa ggaatcttat 241 tgtccacccc gtgtcttggc aaaagaacag tag //