LOCUS       BT009845                 273 bp    mRNA    linear   HUM 02-AUG-2003
DEFINITION  Homo sapiens TP53 target gene 1 mRNA, complete cds.
ACCESSION   BT009845
VERSION     BT009845.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 273)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-JUL-2003) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
REFERENCE   2  (bases 1 to 273)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-AUG-2003) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..273
                     /db_xref="H-InvDB:HIT000266407"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01059X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..273
                     /codon_start=1
                     /product="TP53 target gene 1"
                     /protein_id="AAP88847.1"
                     /translation="MMLGSLAPDPGSRRHSGQAALRPRRYPTLWDRCRKRWLRPIFTQ
                     LLAAGLAYHTLLPIPSEPLFAAPGEHLHQCFVKESYCPPRVLAKEQ"
BASE COUNT           62 a           85 c           68 g           58 t
ORIGIN      
        1 atgatgctgg ggagcttggc gcctgaccca ggatctagaa ggcactctgg gcaggccgcg
       61 ctccgcccac gaaggtaccc aaccctctgg gatagatgca ggaagcgatg gttaagaccc
      121 attttcaccc aacttctcgc cgcaggtctg gcttaccaca cgctcctccc cattcccagt
      181 gagccgcttt ttgcagcacc aggcgaacac ttacaccagt gctttgtaaa ggaatcttat
      241 tgtccacccc gtgtcttggc aaaagaacag tag
//