LOCUS BT009835 582 bp mRNA linear HUM 02-AUG-2003 DEFINITION Homo sapiens hippocalcin-like 1 mRNA, complete cds. ACCESSION BT009835 VERSION BT009835.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 582) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (17-JUL-2003) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA REFERENCE 2 (bases 1 to 582) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (02-AUG-2003) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..582 /db_xref="H-InvDB:HIT000266397" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01089X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..582 /codon_start=1 /product="hippocalcin-like 1" /protein_id="AAP88837.1" /translation="MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLT VDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLK WAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNN DGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF" BASE COUNT 141 a 177 c 169 g 95 t ORIGIN 1 atgggcaaac agaacagcaa gctgcggccc gaggtgctgc aggacctgcg ggagaacacg 61 gagttcaccg accacgagct gcaggagtgg tacaagggct tcctcaagga ctgccccacc 121 ggccacctga ccgtggacga gttcaagaag atctacgcca acttcttccc ctacggcgac 181 gcttccaagt tcgccgagca cgtcttccgc accttcgaca ccaacggcga cggcaccatc 241 gacttccggg agttcatcat tgcgctgagc gtgacctcgc ggggcaagct ggagcagaag 301 ctcaagtggg ccttcagcat gtacgacctg gacggcaacg gctacatcag ccgcagcgag 361 atgctggaga tcgtgcaggc catctacaag atggtgtcgt ctgtgatgaa gatgccggag 421 gatgagtcca ccccggagaa gcgcacagac aagatcttca ggcagatgga caccaacaat 481 gacggcaaac tgtccttgga agaattcatc agaggtgcca agagcgaccc ctccatcgtc 541 cgcctgctgc agtgcgaccc cagcagtgcc agtcagttct ag //