LOCUS       BT009835                 582 bp    mRNA    linear   HUM 02-AUG-2003
DEFINITION  Homo sapiens hippocalcin-like 1 mRNA, complete cds.
ACCESSION   BT009835
VERSION     BT009835.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 582)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-JUL-2003) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
REFERENCE   2  (bases 1 to 582)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-AUG-2003) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..582
                     /db_xref="H-InvDB:HIT000266397"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01089X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..582
                     /codon_start=1
                     /product="hippocalcin-like 1"
                     /protein_id="AAP88837.1"
                     /translation="MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLT
                     VDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLK
                     WAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNN
                     DGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF"
BASE COUNT          141 a          177 c          169 g           95 t
ORIGIN      
        1 atgggcaaac agaacagcaa gctgcggccc gaggtgctgc aggacctgcg ggagaacacg
       61 gagttcaccg accacgagct gcaggagtgg tacaagggct tcctcaagga ctgccccacc
      121 ggccacctga ccgtggacga gttcaagaag atctacgcca acttcttccc ctacggcgac
      181 gcttccaagt tcgccgagca cgtcttccgc accttcgaca ccaacggcga cggcaccatc
      241 gacttccggg agttcatcat tgcgctgagc gtgacctcgc ggggcaagct ggagcagaag
      301 ctcaagtggg ccttcagcat gtacgacctg gacggcaacg gctacatcag ccgcagcgag
      361 atgctggaga tcgtgcaggc catctacaag atggtgtcgt ctgtgatgaa gatgccggag
      421 gatgagtcca ccccggagaa gcgcacagac aagatcttca ggcagatgga caccaacaat
      481 gacggcaaac tgtccttgga agaattcatc agaggtgcca agagcgaccc ctccatcgtc
      541 cgcctgctgc agtgcgaccc cagcagtgcc agtcagttct ag
//