LOCUS BT009833 582 bp mRNA linear HUM 02-AUG-2003 DEFINITION Homo sapiens adaptor-related protein complex 3, sigma 1 subunit mRNA, complete cds. ACCESSION BT009833 VERSION BT009833.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 582) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (17-JUL-2003) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA REFERENCE 2 (bases 1 to 582) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (02-AUG-2003) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..582 /db_xref="H-InvDB:HIT000266395" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01087X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..582 /codon_start=1 /product="adaptor-related protein complex 3, sigma 1 subunit" /protein_id="AAP88835.1" /translation="MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDE NVCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFE NVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPAR AVSAVKNMNLPEIPRNINIGDISIKVPNLPSFK" BASE COUNT 191 a 98 c 125 g 168 t ORIGIN 1 atgatcaagg cgatcctaat cttcaacaac cacgggaagc cgcggctctc caagttctac 61 cagccctaca gtgaagatac acaacagcaa atcatcaggg agactttcca tttggtatct 121 aagagagatg aaaatgtttg taatttccta gaaggaggat tattaattgg aggatctgac 181 aacaaactga tttatagaca ttatgcaacg ttatattttg tcttctgtgt ggattcttca 241 gaaagtgaac ttggcatttt agatctaatt caagtatttg tggaaacatt agacaaatgt 301 tttgaaaatg tctgtgagct ggatttgatt ttccatgtag acaaggttca caatattctt 361 gcagaaatgg tgatgggggg aatggtattg gagacaaata tgaatgagat tgttacacaa 421 attgatgcac aaaataagct ggaaaaatct gaggctggct tagcaggagc tccagcccgt 481 gctgtatcag ctgtaaagaa tatgaatctt cctgagatcc caagaaatat taacattggt 541 gacatcagta taaaagtgcc aaacctgccc tcttttaaat ag //