LOCUS       BT009833                 582 bp    mRNA    linear   HUM 02-AUG-2003
DEFINITION  Homo sapiens adaptor-related protein complex 3, sigma 1 subunit
            mRNA, complete cds.
ACCESSION   BT009833
VERSION     BT009833.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 582)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-JUL-2003) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
REFERENCE   2  (bases 1 to 582)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-AUG-2003) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..582
                     /db_xref="H-InvDB:HIT000266395"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01087X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..582
                     /codon_start=1
                     /product="adaptor-related protein complex 3, sigma 1
                     subunit"
                     /protein_id="AAP88835.1"
                     /translation="MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDE
                     NVCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFE
                     NVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPAR
                     AVSAVKNMNLPEIPRNINIGDISIKVPNLPSFK"
BASE COUNT          191 a           98 c          125 g          168 t
ORIGIN      
        1 atgatcaagg cgatcctaat cttcaacaac cacgggaagc cgcggctctc caagttctac
       61 cagccctaca gtgaagatac acaacagcaa atcatcaggg agactttcca tttggtatct
      121 aagagagatg aaaatgtttg taatttccta gaaggaggat tattaattgg aggatctgac
      181 aacaaactga tttatagaca ttatgcaacg ttatattttg tcttctgtgt ggattcttca
      241 gaaagtgaac ttggcatttt agatctaatt caagtatttg tggaaacatt agacaaatgt
      301 tttgaaaatg tctgtgagct ggatttgatt ttccatgtag acaaggttca caatattctt
      361 gcagaaatgg tgatgggggg aatggtattg gagacaaata tgaatgagat tgttacacaa
      421 attgatgcac aaaataagct ggaaaaatct gaggctggct tagcaggagc tccagcccgt
      481 gctgtatcag ctgtaaagaa tatgaatctt cctgagatcc caagaaatat taacattggt
      541 gacatcagta taaaagtgcc aaacctgccc tcttttaaat ag
//