LOCUS       BT009770                 702 bp    mRNA    linear   HUM 02-AUG-2003
DEFINITION  Homo sapiens frequently rearranged in advanced T-cell lymphomas
            mRNA, complete cds.
ACCESSION   BT009770
VERSION     BT009770.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 702)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-JUL-2003) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
REFERENCE   2  (bases 1 to 702)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-AUG-2003) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..702
                     /db_xref="H-InvDB:HIT000266332"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01037X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..702
                     /codon_start=1
                     /product="frequently rearranged in advanced T-cell
                     lymphomas"
                     /protein_id="AAP88772.1"
                     /translation="MPCRREEEEEAGEEAEGEEEEDDSFLLLQQSVTLGSSGEVDRLV
                     AQIGETLQLDAAQDSPASPCAPPGVPLRAPGPLAAAVPTDKARPPAVPLLLPPASAET
                     VGPAPSGALRCALGDRGRVRGRAAPYCVAEVAAGPSALPGPCRRGWLRDAVTSRRLQQ
                     RRWTQAGARAGDDDPHRLLQQLVLSGNLIKEAVRRLQRAVAAVAATGPASAPGPGGGR
                     SGPDRIALQPSGSLL"
BASE COUNT           91 a          255 c          279 g           77 t
ORIGIN      
        1 atgccgtgcc ggagggagga ggaagaggaa gccggcgagg aggcggaggg ggaggaagag
       61 gaggacgaca gcttcctcct gctgcagcag tcggtgacgc tgggcagctc gggcgaggtg
      121 gaccggctgg tggcccagat cggcgagacg ctgcagctgg acgcggcgca ggacagcccg
      181 gcctcgccgt gcgcgccccc gggggtgccg ctgcgggccc cggggcccct ggctgcggcg
      241 gtgccgacgg acaaggcccg gcccccggcg gtgccgctgc tgctgccgcc cgcttcggct
      301 gagacggtgg gcccggcgcc ctctggggcc ctgcgctgcg ccctagggga ccgcggccgc
      361 gtgcgcggac gcgctgcgcc ctactgcgtg gcggaggtcg ccgcaggccc cagcgcgctg
      421 ccggggccgt gccggcgagg atggctcagg gacgcggtca cctcccgccg cttgcagcag
      481 cgccgatgga cccaagccgg ggcacgcgcc ggcgacgacg acccgcatcg gctcctccag
      541 cagctcgtgc tctcgggaaa cctcatcaag gaagccgtgc ggagactcca acgagccgtc
      601 gccgcggttg cagccacggg ccccgcaagc gcccctgggc ccgggggagg ccgcagcgga
      661 cctgaccgca ttgccctgca gccctcaggc tccttgctct ag
//