LOCUS BT009770 702 bp mRNA linear HUM 02-AUG-2003 DEFINITION Homo sapiens frequently rearranged in advanced T-cell lymphomas mRNA, complete cds. ACCESSION BT009770 VERSION BT009770.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 702) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (17-JUL-2003) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA REFERENCE 2 (bases 1 to 702) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (02-AUG-2003) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..702 /db_xref="H-InvDB:HIT000266332" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01037X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..702 /codon_start=1 /product="frequently rearranged in advanced T-cell lymphomas" /protein_id="AAP88772.1" /translation="MPCRREEEEEAGEEAEGEEEEDDSFLLLQQSVTLGSSGEVDRLV AQIGETLQLDAAQDSPASPCAPPGVPLRAPGPLAAAVPTDKARPPAVPLLLPPASAET VGPAPSGALRCALGDRGRVRGRAAPYCVAEVAAGPSALPGPCRRGWLRDAVTSRRLQQ RRWTQAGARAGDDDPHRLLQQLVLSGNLIKEAVRRLQRAVAAVAATGPASAPGPGGGR SGPDRIALQPSGSLL" BASE COUNT 91 a 255 c 279 g 77 t ORIGIN 1 atgccgtgcc ggagggagga ggaagaggaa gccggcgagg aggcggaggg ggaggaagag 61 gaggacgaca gcttcctcct gctgcagcag tcggtgacgc tgggcagctc gggcgaggtg 121 gaccggctgg tggcccagat cggcgagacg ctgcagctgg acgcggcgca ggacagcccg 181 gcctcgccgt gcgcgccccc gggggtgccg ctgcgggccc cggggcccct ggctgcggcg 241 gtgccgacgg acaaggcccg gcccccggcg gtgccgctgc tgctgccgcc cgcttcggct 301 gagacggtgg gcccggcgcc ctctggggcc ctgcgctgcg ccctagggga ccgcggccgc 361 gtgcgcggac gcgctgcgcc ctactgcgtg gcggaggtcg ccgcaggccc cagcgcgctg 421 ccggggccgt gccggcgagg atggctcagg gacgcggtca cctcccgccg cttgcagcag 481 cgccgatgga cccaagccgg ggcacgcgcc ggcgacgacg acccgcatcg gctcctccag 541 cagctcgtgc tctcgggaaa cctcatcaag gaagccgtgc ggagactcca acgagccgtc 601 gccgcggttg cagccacggg ccccgcaagc gcccctgggc ccgggggagg ccgcagcgga 661 cctgaccgca ttgccctgca gccctcaggc tccttgctct ag //