LOCUS BT007398 660 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens phosphodiesterase 4D, cAMP-specific (phosphodiesterase E3 dunce homolog, Drosophila) mRNA, complete cds. ACCESSION BT007398 VERSION BT007398.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 660) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 660) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..660 /db_xref="H-InvDB:HIT000100318" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00988X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..660 /codon_start=1 /product="phosphodiesterase 4D, cAMP-specific (phosphodiesterase E3 dunce homolog, Drosophila)" /protein_id="AAP36062.1" /translation="MAQQTSPDTLTVPEVDNPHCPNPWLNEDLVKSLRENLLQHEKSK TARKSVSPKLSPVISPRNSPRLLRRMLLSSNIPKQRRFTVAHTCFDVDNGTSAGRSPL DPMTSPGSGLILQANFVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVT PFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITGSWMELNPYTLLD M" BASE COUNT 182 a 184 c 142 g 152 t ORIGIN 1 atggctcagc agacaagccc ggacacttta acagtacctg aagtggataa tccgcattgt 61 ccaaacccgt ggctgaacga agaccttgtg aaatccttgc gagaaaacct gttgcagcat 121 gagaagtcca agacagcgag gaaatcggtt tctcccaagc tctctccagt gatctctccg 181 agaaattccc ccaggcttct gcgcagaatg cttctcagca gcaacatccc caaacagcgg 241 cgtttcacgg tggcacatac atgttttgat gtggacaatg gcacatctgc gggacggagt 301 cccttggatc ccatgaccag cccaggatcc gggctaattc tccaagcaaa ttttgtccac 361 agtcaacgac gggagtcctt cctgtatcga tccgacagcg attatgacct ctctccaaag 421 tctatgtccc ggaactcctc cattgccagt gatatacacg gagatgactt gattgtgact 481 ccatttgctc aggtcttggc cagtctgcga actgtacgaa acaactttgc tgcattaact 541 aatttgcaag atcgagcacc tagcaaaaga tcacccatgt gcaaccaacc atccatcaac 601 aaagccacca taacaggatc ctggatggaa ttgaacccat atacgttact tgacatgtag //