LOCUS       BT007398                 660 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens phosphodiesterase 4D, cAMP-specific (phosphodiesterase
            E3 dunce homolog, Drosophila) mRNA, complete cds.
ACCESSION   BT007398
VERSION     BT007398.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 660)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 660)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..660
                     /db_xref="H-InvDB:HIT000100318"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00988X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..660
                     /codon_start=1
                     /product="phosphodiesterase 4D, cAMP-specific
                     (phosphodiesterase E3 dunce homolog, Drosophila)"
                     /protein_id="AAP36062.1"
                     /translation="MAQQTSPDTLTVPEVDNPHCPNPWLNEDLVKSLRENLLQHEKSK
                     TARKSVSPKLSPVISPRNSPRLLRRMLLSSNIPKQRRFTVAHTCFDVDNGTSAGRSPL
                     DPMTSPGSGLILQANFVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVT
                     PFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITGSWMELNPYTLLD
                     M"
BASE COUNT          182 a          184 c          142 g          152 t
ORIGIN      
        1 atggctcagc agacaagccc ggacacttta acagtacctg aagtggataa tccgcattgt
       61 ccaaacccgt ggctgaacga agaccttgtg aaatccttgc gagaaaacct gttgcagcat
      121 gagaagtcca agacagcgag gaaatcggtt tctcccaagc tctctccagt gatctctccg
      181 agaaattccc ccaggcttct gcgcagaatg cttctcagca gcaacatccc caaacagcgg
      241 cgtttcacgg tggcacatac atgttttgat gtggacaatg gcacatctgc gggacggagt
      301 cccttggatc ccatgaccag cccaggatcc gggctaattc tccaagcaaa ttttgtccac
      361 agtcaacgac gggagtcctt cctgtatcga tccgacagcg attatgacct ctctccaaag
      421 tctatgtccc ggaactcctc cattgccagt gatatacacg gagatgactt gattgtgact
      481 ccatttgctc aggtcttggc cagtctgcga actgtacgaa acaactttgc tgcattaact
      541 aatttgcaag atcgagcacc tagcaaaaga tcacccatgt gcaaccaacc atccatcaac
      601 aaagccacca taacaggatc ctggatggaa ttgaacccat atacgttact tgacatgtag
//