LOCUS       BT007375                 447 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens heat shock protein, 110 kDa mRNA, complete cds.
ACCESSION   BT007375
VERSION     BT007375.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 447)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 447)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..447
                     /db_xref="H-InvDB:HIT000100295"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00219X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..447
                     /codon_start=1
                     /product="heat shock protein, 110 kDa"
                     /protein_id="AAP36039.1"
                     /translation="MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPK
                     NRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIK
                     VTYMEEEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID"
BASE COUNT          125 a           99 c          122 g          101 t
ORIGIN      
        1 atgtcggtgg tgggcataga cctgggcttc cagagctgct acgtcgctgt ggcccgcgcc
       61 ggcggcatcg agactatcgc taatgagtat agcgaccgct gcacgccggc ttgcatttct
      121 tttggtccta agaatcgttc aattggagca gcagctaaaa gccaggtaat ttctaatgca
      181 aagaacacag tccaaggatt taaaagattc catggccgag cattctctga tccatttgtg
      241 gaggcagaaa aatctaacct tgcatatgat attgtgcagt tgcctacagg attaacaggt
      301 ataaaggtga catatatgga ggaagagcag aatggaccag tggatggaca aggagacaac
      361 ccaggccccc aggctgctga gcagggtaca gacacagctg tgccttcgga ttcagacaag
      421 aagcttcctg aaatggacat tgattag
//