LOCUS BT007375 447 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens heat shock protein, 110 kDa mRNA, complete cds. ACCESSION BT007375 VERSION BT007375.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 447) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 447) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..447 /db_xref="H-InvDB:HIT000100295" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00219X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..447 /codon_start=1 /product="heat shock protein, 110 kDa" /protein_id="AAP36039.1" /translation="MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPK NRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIK VTYMEEEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID" BASE COUNT 125 a 99 c 122 g 101 t ORIGIN 1 atgtcggtgg tgggcataga cctgggcttc cagagctgct acgtcgctgt ggcccgcgcc 61 ggcggcatcg agactatcgc taatgagtat agcgaccgct gcacgccggc ttgcatttct 121 tttggtccta agaatcgttc aattggagca gcagctaaaa gccaggtaat ttctaatgca 181 aagaacacag tccaaggatt taaaagattc catggccgag cattctctga tccatttgtg 241 gaggcagaaa aatctaacct tgcatatgat attgtgcagt tgcctacagg attaacaggt 301 ataaaggtga catatatgga ggaagagcag aatggaccag tggatggaca aggagacaac 361 ccaggccccc aggctgctga gcagggtaca gacacagctg tgccttcgga ttcagacaag 421 aagcttcctg aaatggacat tgattag //