LOCUS       BT007355                 222 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens ubiquitin-like 5 mRNA, complete cds.
ACCESSION   BT007355
VERSION     BT007355.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 222)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 222)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..222
                     /db_xref="H-InvDB:HIT000100275"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00020X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..222
                     /codon_start=1
                     /product="ubiquitin-like 5"
                     /protein_id="AAP36019.1"
                     /translation="MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVL
                     KKWYTIFKDHVSLGDYEIHDGMNLELYYQ"
BASE COUNT           63 a           44 c           62 g           53 t
ORIGIN      
        1 atgatcgagg ttgtttgcaa cgaccgtctg gggaagaagg tccgcgttaa atgcaacacg
       61 gatgatacca tcggggacct taagaagctg attgcagccc aaactggtac ccgttggaac
      121 aagattgtcc tgaagaagtg gtacacgatt tttaaggacc acgtgtctct gggggactat
      181 gaaatccacg atgggatgaa cctggagctt tattatcaat ag
//