LOCUS BT007354 327 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens tubulin-specific chaperone a mRNA, complete cds. ACCESSION BT007354 VERSION BT007354.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 327) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 327) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..327 /db_xref="H-InvDB:HIT000100274" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00019X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..327 /codon_start=1 /product="tubulin-specific chaperone a" /protein_id="AAP36018.1" /translation="MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAED GENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLD SVKLEA" BASE COUNT 129 a 49 c 88 g 61 t ORIGIN 1 atggccgatc ctcgcgtgag acagatcaag atcaagaccg gcgtggtgaa gcggttggtc 61 aaagaaaaag tgatgtatga aaaagaggca aaacaacaag aagaaaagat tgaaaaaatg 121 agagctgaag acggtgaaaa ttatgacatt aaaaagcagg cagagatcct acaagaatcc 181 aggatgatga tcccagattg ccagcgcagg ttggaagccg catatttgga tcttcaacgg 241 atactagaaa atgaaaaaga cttggaagaa gctgaggaat ataaagaagc acgtttagta 301 ctggattcag tgaagttaga agcctag //