LOCUS BT007348 342 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens ring finger protein 7 mRNA, complete cds. ACCESSION BT007348 VERSION BT007348.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 342) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 342) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..342 /db_xref="H-InvDB:HIT000100268" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00912X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..342 /codon_start=1 /product="ring finger protein 7" /protein_id="AAP36012.1" /translation="MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWD VECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLC QQDWVVQRIGK" BASE COUNT 82 a 83 c 109 g 68 t ORIGIN 1 atggccgacg tggaagacgg agaggaaacc tgcgccctgg cctctcactc cgggagctca 61 ggctccaagt cgggaggcga caagatgttc tccctcaaga agtggaacgc ggtggccatg 121 tggagctggg acgtggagtg cgatacgtgc gccatctgca gggtccaggt gatggatgcc 181 tgtcttagat gtcaagctga aaacaaacaa gaggactgtg ttgtggtctg gggagaatgt 241 aatcattcct tccacaactg ctgcatgtcc ctgtgggtga aacagaacaa tcgctgccct 301 ctctgccagc aggactgggt ggtccaaaga atcggcaaat ag //