LOCUS BT007339 405 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens RAD51 homolog C (S. cerevisiae) mRNA, complete cds. ACCESSION BT007339 VERSION BT007339.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 405) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 405) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..405 /db_xref="H-InvDB:HIT000100259" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00907X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..405 /codon_start=1 /product="RAD51 homolog C (S. cerevisiae)" /protein_id="AAP36003.1" /translation="MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPS ELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIIT FCSALDDILGGGVPLMKTTEICGAPGVGKTQL" BASE COUNT 118 a 83 c 108 g 96 t ORIGIN 1 atgcgcggga agacgttccg ctttgaaatg cagcgggatt tggtgagttt cccgctgtct 61 ccagcggtgc gggtgaagct ggtgtctgcg gggttccaga ctgctgagga actcctagag 121 gtgaaaccct ccgagcttag caaagaagtt gggatatcta aagcagaagc cttagaaact 181 ctgcaaatta tcagaagaga atgtctcaca aataaaccaa gatatgctgg tacatctgag 241 tcacacaaga agtgtacagc actggaactt cttgagcagg agcataccca gggcttcata 301 atcaccttct gttcagcact agatgatatt cttgggggtg gagtgccctt aatgaaaaca 361 acagaaattt gtggtgcacc aggtgttgga aaaacacaat tatag //