LOCUS       BT007327                 303 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens vesicle-associated membrane protein 3 (cellubrevin)
            mRNA, complete cds.
ACCESSION   BT007327
VERSION     BT007327.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 303)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 303)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..303
                     /db_xref="H-InvDB:HIT000100247"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00024X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..303
                     /codon_start=1
                     /product="vesicle-associated membrane protein 3
                     (cellubrevin)"
                     /protein_id="AAP35991.1"
                     /translation="MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLS
                     ELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS"
BASE COUNT           87 a           60 c           83 g           73 t
ORIGIN      
        1 atgtctacag gtccaactgc tgccactggc agtaatcgaa gacttcagca gacacaaaat
       61 caagtagatg aggtggtgga cataatgcga gttaacgtgg acaaggttct ggaaagagac
      121 cagaagctct ctgagttaga cgaccgtgca gacgcactgc aggcaggcgc ttctcaattt
      181 gaaacgagcg cagccaagtt gaagaggaaa tattggtgga agaattgcaa gatgtgggca
      241 atcgggatta ctgttctggt tatcttcatc atcatcatca tcgtgtgggt tgtctcttca
      301 tag
//