LOCUS BT007327 303 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens vesicle-associated membrane protein 3 (cellubrevin) mRNA, complete cds. ACCESSION BT007327 VERSION BT007327.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 303) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 303) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..303 /db_xref="H-InvDB:HIT000100247" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00024X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..303 /codon_start=1 /product="vesicle-associated membrane protein 3 (cellubrevin)" /protein_id="AAP35991.1" /translation="MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLS ELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS" BASE COUNT 87 a 60 c 83 g 73 t ORIGIN 1 atgtctacag gtccaactgc tgccactggc agtaatcgaa gacttcagca gacacaaaat 61 caagtagatg aggtggtgga cataatgcga gttaacgtgg acaaggttct ggaaagagac 121 cagaagctct ctgagttaga cgaccgtgca gacgcactgc aggcaggcgc ttctcaattt 181 gaaacgagcg cagccaagtt gaagaggaaa tattggtgga agaattgcaa gatgtgggca 241 atcgggatta ctgttctggt tatcttcatc atcatcatca tcgtgtgggt tgtctcttca 301 tag //