LOCUS BT007320 366 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens replication protein A3, 14kDa mRNA, complete cds. ACCESSION BT007320 VERSION BT007320.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 366) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 366) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..366 /db_xref="H-InvDB:HIT000100240" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00892X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..366 /codon_start=1 /product="replication protein A3, 14kDa" /protein_id="AAP35984.1" /translation="MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILS DGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEA VKIIHDFPQFYPLGIVQHD" BASE COUNT 104 a 74 c 87 g 101 t ORIGIN 1 atggtggaca tgatggactt gcccaggtcg cgcatcaacg ccggcatgct agctcaattc 61 atcgacaagc ctgtctgctt cgtagggagg ctggaaaaga ttcatcccac cggaaaaatg 121 tttattcttt cagatggaga aggaaaaaat ggaaccatcg agttgatgga accccttgat 181 gaagaaatct ctggaattgt ggaagtggtt ggaagagtaa ccgccaaggc caccatcttg 241 tgtacatctt atgtccagtt taaagaagat agccatcctt ttgatcttgg actttacaat 301 gaagctgtga aaattatcca tgacttccct cagttttatc ctttagggat tgtgcaacat 361 gattag //