LOCUS       BT007320                 366 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens replication protein A3, 14kDa mRNA, complete cds.
ACCESSION   BT007320
VERSION     BT007320.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 366)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 366)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..366
                     /db_xref="H-InvDB:HIT000100240"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00892X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..366
                     /codon_start=1
                     /product="replication protein A3, 14kDa"
                     /protein_id="AAP35984.1"
                     /translation="MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILS
                     DGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEA
                     VKIIHDFPQFYPLGIVQHD"
BASE COUNT          104 a           74 c           87 g          101 t
ORIGIN      
        1 atggtggaca tgatggactt gcccaggtcg cgcatcaacg ccggcatgct agctcaattc
       61 atcgacaagc ctgtctgctt cgtagggagg ctggaaaaga ttcatcccac cggaaaaatg
      121 tttattcttt cagatggaga aggaaaaaat ggaaccatcg agttgatgga accccttgat
      181 gaagaaatct ctggaattgt ggaagtggtt ggaagagtaa ccgccaaggc caccatcttg
      241 tgtacatctt atgtccagtt taaagaagat agccatcctt ttgatcttgg actttacaat
      301 gaagctgtga aaattatcca tgacttccct cagttttatc ctttagggat tgtgcaacat
      361 gattag
//