LOCUS       BT007260                 546 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens ADP-ribosylation factor-like 1 mRNA, complete cds.
ACCESSION   BT007260
VERSION     BT007260.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 546)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 546)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..546
                     /db_xref="H-InvDB:HIT000100180"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00848X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..546
                     /codon_start=1
                     /product="ADP-ribosylation factor-like 1"
                     /protein_id="AAP35924.1"
                     /translation="MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVT
                     TIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGI
                     SKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSA
                     TKGTGLDEAMEWLVETLKSRQ"
BASE COUNT          180 a           89 c          134 g          143 t
ORIGIN      
        1 atgggtggct ttttctcaag tatattttcc agtctgtttg gaactcggga aatgagaatt
       61 ttaattttgg gattagatgg agcaggaaaa accacaattt tgtacagatt acaagtggga
      121 gaagttgtta ctactatacc taccattgga tttaatgtag agacggtgac gtacaaaaac
      181 cttaaattcc aagtctggga tttaggagga cagacaagta tcaggccata ctggagatgt
      241 tactattcaa acacagatgc agtcatttat gtagtagaca gttgtgaccg agaccgaatt
      301 ggcatttcca aatcagagtt agttgccatg ttggaggaag aagagctgag aaaagccatt
      361 ttagtggtgt ttgcaaataa acaggacatg gaacaggcca tgacttcctc agagatggca
      421 aattcacttg ggttacctgc cttgaaggac cgaaaatggc agatattcaa aacgtcagca
      481 accaaaggca ccggccttga tgaggcaatg gaatggttag ttgaaacatt aaaaagcaga
      541 cagtag
//