LOCUS BT007260 546 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens ADP-ribosylation factor-like 1 mRNA, complete cds. ACCESSION BT007260 VERSION BT007260.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 546) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 546) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..546 /db_xref="H-InvDB:HIT000100180" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00848X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..546 /codon_start=1 /product="ADP-ribosylation factor-like 1" /protein_id="AAP35924.1" /translation="MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVT TIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGI SKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSA TKGTGLDEAMEWLVETLKSRQ" BASE COUNT 180 a 89 c 134 g 143 t ORIGIN 1 atgggtggct ttttctcaag tatattttcc agtctgtttg gaactcggga aatgagaatt 61 ttaattttgg gattagatgg agcaggaaaa accacaattt tgtacagatt acaagtggga 121 gaagttgtta ctactatacc taccattgga tttaatgtag agacggtgac gtacaaaaac 181 cttaaattcc aagtctggga tttaggagga cagacaagta tcaggccata ctggagatgt 241 tactattcaa acacagatgc agtcatttat gtagtagaca gttgtgaccg agaccgaatt 301 ggcatttcca aatcagagtt agttgccatg ttggaggaag aagagctgag aaaagccatt 361 ttagtggtgt ttgcaaataa acaggacatg gaacaggcca tgacttcctc agagatggca 421 aattcacttg ggttacctgc cttgaaggac cgaaaatggc agatattcaa aacgtcagca 481 accaaaggca ccggccttga tgaggcaatg gaatggttag ttgaaacatt aaaaagcaga 541 cagtag //