LOCUS       BT007257                 579 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens G protein-coupled receptor mRNA, complete cds.
ACCESSION   BT007257
VERSION     BT007257.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 579)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 579)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..579
                     /db_xref="H-InvDB:HIT000100177"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00034X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..579
                     /codon_start=1
                     /product="G protein-coupled receptor"
                     /protein_id="AAP35921.1"
                     /translation="MLQMDSRIAGYYYARFTVGFAIPLSIIAFTNHRIFRSIKQSMGL
                     SAAQKAKVKHSAIAVVVIFLVCFAPYHLVLLVKAAAFSYYRGDRNAMCGLEERLYTAS
                     VVFLCLSTVNGVADPIIYVLATDHSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQ
                     SPVALADHYTFSRPVHPPGSPCPAKRLIEESC"
BASE COUNT          123 a          182 c          156 g          118 t
ORIGIN      
        1 atgctgcaga tggacagcag gattgccggg tactactacg ccaggttcac cgttggcttt
       61 gccatccctc tctccatcat cgccttcacc aaccaccgga ttttcaggag catcaagcag
      121 agcatgggct taagcgctgc ccagaaggcc aaggtgaagc actcggccat cgcggtggtt
      181 gtcatcttcc tagtctgctt cgccccgtac cacctggttc tcctcgtcaa agccgctgcc
      241 ttttcctact acagaggaga caggaacgcc atgtgcggct tggaggaaag gctgtacaca
      301 gcctctgtgg tgtttctgtg cctgtccacg gtgaacggcg tggctgaccc cattatctac
      361 gtgctggcca cggaccattc ccgccaagaa gtgtccagaa tccataaggg gtggaaagag
      421 tggtccatga agacagacgt caccaggctc acccacagca gggacaccga ggagctgcag
      481 tcgcccgtgg cccttgcaga ccactacacc ttctccaggc ccgtgcaccc accagggtca
      541 ccatgccctg caaagaggct gattgaggag tcctgctag
//