LOCUS BT007257 579 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens G protein-coupled receptor mRNA, complete cds. ACCESSION BT007257 VERSION BT007257.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 579) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 579) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..579 /db_xref="H-InvDB:HIT000100177" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00034X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..579 /codon_start=1 /product="G protein-coupled receptor" /protein_id="AAP35921.1" /translation="MLQMDSRIAGYYYARFTVGFAIPLSIIAFTNHRIFRSIKQSMGL SAAQKAKVKHSAIAVVVIFLVCFAPYHLVLLVKAAAFSYYRGDRNAMCGLEERLYTAS VVFLCLSTVNGVADPIIYVLATDHSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQ SPVALADHYTFSRPVHPPGSPCPAKRLIEESC" BASE COUNT 123 a 182 c 156 g 118 t ORIGIN 1 atgctgcaga tggacagcag gattgccggg tactactacg ccaggttcac cgttggcttt 61 gccatccctc tctccatcat cgccttcacc aaccaccgga ttttcaggag catcaagcag 121 agcatgggct taagcgctgc ccagaaggcc aaggtgaagc actcggccat cgcggtggtt 181 gtcatcttcc tagtctgctt cgccccgtac cacctggttc tcctcgtcaa agccgctgcc 241 ttttcctact acagaggaga caggaacgcc atgtgcggct tggaggaaag gctgtacaca 301 gcctctgtgg tgtttctgtg cctgtccacg gtgaacggcg tggctgaccc cattatctac 361 gtgctggcca cggaccattc ccgccaagaa gtgtccagaa tccataaggg gtggaaagag 421 tggtccatga agacagacgt caccaggctc acccacagca gggacaccga ggagctgcag 481 tcgcccgtgg cccttgcaga ccactacacc ttctccaggc ccgtgcaccc accagggtca 541 ccatgccctg caaagaggct gattgaggag tcctgctag //