LOCUS BT007244 327 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6 mRNA, complete cds. ACCESSION BT007244 VERSION BT007244.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 327) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 327) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..327 /db_xref="H-InvDB:HIT000100164" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00202X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..327 /codon_start=1 /product="ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6" /protein_id="AAP35908.1" /translation="MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFV DKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEV IEKPQA" BASE COUNT 98 a 67 c 73 g 89 t ORIGIN 1 atgattcttc agaggctctt caggttctcc tctgtcattc ggtcagccgt ctcagtccat 61 ttgcggagga acattggtgt tacagcagtg gcatttaata aggaacttga tcctatacag 121 aaactctttg tggacaagat tagagaatac aaatctaagc gacagacatc tggaggacct 181 gttgatgcta gttcagagta tcagcaagag ctggagaggg agctttttaa gctcaagcaa 241 atgtttggta atgcagacat gaatacattt cccaccttca aatttgaaga tcccaaattt 301 gaagtcatcg aaaaacccca ggcctag //