LOCUS       BT007203                 519 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens sorting nexin 12 mRNA, complete cds.
ACCESSION   BT007203
VERSION     BT007203.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 519)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 519)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..519
                     /db_xref="H-InvDB:HIT000100123"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00250X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..519
                     /codon_start=1
                     /product="sorting nexin 12"
                     /protein_id="AAP35867.1"
                     /translation="MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGR
                     ARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQL
                     PFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKS
                     LAVSCPGWSAVA"
BASE COUNT          129 a          131 c          153 g          106 t
ORIGIN      
        1 atgtcggaca cggcagtagc tgatacccgg cgccttaact cgaagccgca ggacctgacc
       61 gacgcttacg ggccgccaag taacttcctg gagatcgaca tctttaatcc tcagacggtg
      121 ggcgtgggac gcgcgcgctt caccacctat gaggttcgca tgcggacaaa cctacctatc
      181 ttcaagctaa aggagtcctg cgtacggcgg cgctacagtg actttgagtg gctgaaaaat
      241 gagctggaga gagatagcaa gattgtagta ccaccactgc ctgggaaagc cttgaagcgg
      301 cagctccctt tccgaggaga tgaagggatc tttgaggagt ctttcatcga agaaaggagg
      361 cagggcctcg agcagtttat taacaaaatt gctgggcacc cactggctca gaatgaacgc
      421 tgcctacaca tgttcctgca agaggaggca attgacagga actacgtccc ggggaagagt
      481 cttgctgtgt cttgcccagg ctggagtgca gtggcatag
//