LOCUS BT007203 519 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens sorting nexin 12 mRNA, complete cds. ACCESSION BT007203 VERSION BT007203.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 519) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 519) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..519 /db_xref="H-InvDB:HIT000100123" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00250X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..519 /codon_start=1 /product="sorting nexin 12" /protein_id="AAP35867.1" /translation="MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGR ARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQL PFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKS LAVSCPGWSAVA" BASE COUNT 129 a 131 c 153 g 106 t ORIGIN 1 atgtcggaca cggcagtagc tgatacccgg cgccttaact cgaagccgca ggacctgacc 61 gacgcttacg ggccgccaag taacttcctg gagatcgaca tctttaatcc tcagacggtg 121 ggcgtgggac gcgcgcgctt caccacctat gaggttcgca tgcggacaaa cctacctatc 181 ttcaagctaa aggagtcctg cgtacggcgg cgctacagtg actttgagtg gctgaaaaat 241 gagctggaga gagatagcaa gattgtagta ccaccactgc ctgggaaagc cttgaagcgg 301 cagctccctt tccgaggaga tgaagggatc tttgaggagt ctttcatcga agaaaggagg 361 cagggcctcg agcagtttat taacaaaatt gctgggcacc cactggctca gaatgaacgc 421 tgcctacaca tgttcctgca agaggaggca attgacagga actacgtccc ggggaagagt 481 cttgctgtgt cttgcccagg ctggagtgca gtggcatag //