LOCUS       BT007201                 435 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens eukaryotic translation initiation factor 1A, Y
            chromosome mRNA, complete cds.
ACCESSION   BT007201
VERSION     BT007201.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 435)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 435)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..435
                     /db_xref="H-InvDB:HIT000100121"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00043X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..435
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 1A, Y
                     chromosome"
                     /protein_id="AAP35865.1"
                     /translation="MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGN
                     GRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARS
                     LKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI"
BASE COUNT          164 a           48 c          117 g          106 t
ORIGIN      
        1 atgcccaaga ataaaggtaa aggaggtaaa aacaggcgca ggggtaaaaa tgagaatgaa
       61 tctgaaaaaa gagagttggt gtttaaagag gatggacaag agtatgctca ggtaatcaaa
      121 atgttgggaa atggacgatt ggaagcattg tgttttgatg gtgtaaagag gttatgccat
      181 atcagaggga aattgagaaa aaaggtttgg ataaatacat cagacattat attggttggt
      241 ctacgggact atcaggataa caaagctgat gtaattttaa agtacaatgc agatgaagct
      301 agaagcctga aggcatatgg cgagcttcca gaacatgcta aaatcaatga aacagacaca
      361 tttggtcctg gagatgatga tgaaatccag tttgacgata ttggagatga tgatgaagac
      421 attgatgata tctag
//