LOCUS BT007201 435 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens eukaryotic translation initiation factor 1A, Y chromosome mRNA, complete cds. ACCESSION BT007201 VERSION BT007201.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 435) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 435) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..435 /db_xref="H-InvDB:HIT000100121" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00043X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..435 /codon_start=1 /product="eukaryotic translation initiation factor 1A, Y chromosome" /protein_id="AAP35865.1" /translation="MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGN GRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARS LKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI" BASE COUNT 164 a 48 c 117 g 106 t ORIGIN 1 atgcccaaga ataaaggtaa aggaggtaaa aacaggcgca ggggtaaaaa tgagaatgaa 61 tctgaaaaaa gagagttggt gtttaaagag gatggacaag agtatgctca ggtaatcaaa 121 atgttgggaa atggacgatt ggaagcattg tgttttgatg gtgtaaagag gttatgccat 181 atcagaggga aattgagaaa aaaggtttgg ataaatacat cagacattat attggttggt 241 ctacgggact atcaggataa caaagctgat gtaattttaa agtacaatgc agatgaagct 301 agaagcctga aggcatatgg cgagcttcca gaacatgcta aaatcaatga aacagacaca 361 tttggtcctg gagatgatga tgaaatccag tttgacgata ttggagatga tgatgaagac 421 attgatgata tctag //