LOCUS       BT007164                 459 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens ninjurin 1 mRNA, complete cds.
ACCESSION   BT007164
VERSION     BT007164.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 459)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 459)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..459
                     /db_xref="H-InvDB:HIT000100084"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00765X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..459
                     /codon_start=1
                     /product="ninjurin 1"
                     /protein_id="AAP35828.1"
                     /translation="MDSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASK
                     KSAAESMLDIALLMANASQLKAVVEQGPSFAFYVPLVVLISISLVLQIGVGVLLIFLV
                     KYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFGVQKPLMDMAPQQ"
BASE COUNT           87 a          156 c          133 g           83 t
ORIGIN      
        1 atggactcgg gaaccgagga gtacgagctc aacggcggcc tgcctccggg cacacccggc
       61 tccccggacg cctcgccggc ccgctggggc tggaggcacg ggcccatcaa cgtgaaccat
      121 tacgccagca agaagagcgc agccgagagc atgctggaca tcgcgctgct gatggccaac
      181 gcgtcccagc tgaaggccgt cgtggaacag ggccccagct tcgccttcta tgtgcccctg
      241 gtggtcctca tctccatctc ccttgtgctg cagatcggcg tgggggtgct gctcatcttc
      301 cttgtcaagt acgaccttaa caacccggcc aagcacgcca agctggactt cctcaacaac
      361 ctggccacgg gcctggtgtt catcatcgtg gtagtcaaca tcttcatcac ggccttcggg
      421 gtccagaagc ccttgatgga catggcaccc cagcagtag
//