LOCUS BT007164 459 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens ninjurin 1 mRNA, complete cds. ACCESSION BT007164 VERSION BT007164.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 459) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 459) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..459 /db_xref="H-InvDB:HIT000100084" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00765X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..459 /codon_start=1 /product="ninjurin 1" /protein_id="AAP35828.1" /translation="MDSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASK KSAAESMLDIALLMANASQLKAVVEQGPSFAFYVPLVVLISISLVLQIGVGVLLIFLV KYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFGVQKPLMDMAPQQ" BASE COUNT 87 a 156 c 133 g 83 t ORIGIN 1 atggactcgg gaaccgagga gtacgagctc aacggcggcc tgcctccggg cacacccggc 61 tccccggacg cctcgccggc ccgctggggc tggaggcacg ggcccatcaa cgtgaaccat 121 tacgccagca agaagagcgc agccgagagc atgctggaca tcgcgctgct gatggccaac 181 gcgtcccagc tgaaggccgt cgtggaacag ggccccagct tcgccttcta tgtgcccctg 241 gtggtcctca tctccatctc ccttgtgctg cagatcggcg tgggggtgct gctcatcttc 301 cttgtcaagt acgaccttaa caacccggcc aagcacgcca agctggactt cctcaacaac 361 ctggccacgg gcctggtgtt catcatcgtg gtagtcaaca tcttcatcac ggccttcggg 421 gtccagaagc ccttgatgga catggcaccc cagcagtag //