LOCUS       BT007161                 768 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase
            activation protein, epsilon polypeptide mRNA, complete cds.
ACCESSION   BT007161
VERSION     BT007161.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 768)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 768)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..768
                     /db_xref="H-InvDB:HIT000100081"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00253X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..768
                     /codon_start=1
                     /product="tyrosine 3-monooxygenase/tryptophan
                     5-monooxygenase activation protein, epsilon polypeptide"
                     /protein_id="AAP35825.1"
                     /translation="MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNL
                     LSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILD
                     VLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAM
                     TELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDST
                     LIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ"
BASE COUNT          249 a          141 c          205 g          173 t
ORIGIN      
        1 atggatgatc gagaggatct ggtgtaccag gcgaagctgg ccgagcaggc tgagcgatac
       61 gacgaaatgg tggagtcaat gaagaaagta gcagggatgg atgtggagct gacagttgaa
      121 gaaagaaacc tcctatctgt tgcatataag aatgtgattg gagctagaag agcctcctgg
      181 agaataatca gcagcattga acagaaagaa gaaaacaagg gaggagaaga caagctaaaa
      241 atgattcggg aatatcggca aatggttgag actgagctaa agttaatctg ttgtgacatt
      301 ctggatgtac tggacaaaca cctcattcca gcagctaaca ctggcgagtc caaggttttc
      361 tattataaaa tgaaagggga ctaccacagg tatctggcag aatttgccac aggaaacgac
      421 aggaaggagg ctgcggagaa cagcctagtg gcttataaag ctgctagtga tattgcaatg
      481 acagaacttc caccaacgca tcctattcgc ttaggtcttg ctctcaattt ttccgtattc
      541 tactacgaaa ttcttaattc ccctgaccgt gcctgcaggt tggcaaaagc agcttttgat
      601 gatgcaattg cagaactgga tacgctgagt gaagaaagct ataaggactc tacacttatc
      661 atgcagttgt tacgtgataa tctgacacta tggacttcag acatgcaggg tgacggtgaa
      721 gagcagaata aagaagcgct gcaggacgtg gaagacgaaa atcagtag
//