LOCUS BT007161 768 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide mRNA, complete cds. ACCESSION BT007161 VERSION BT007161.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 768) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 768) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..768 /db_xref="H-InvDB:HIT000100081" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00253X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..768 /codon_start=1 /product="tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide" /protein_id="AAP35825.1" /translation="MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNL LSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILD VLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAM TELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDST LIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ" BASE COUNT 249 a 141 c 205 g 173 t ORIGIN 1 atggatgatc gagaggatct ggtgtaccag gcgaagctgg ccgagcaggc tgagcgatac 61 gacgaaatgg tggagtcaat gaagaaagta gcagggatgg atgtggagct gacagttgaa 121 gaaagaaacc tcctatctgt tgcatataag aatgtgattg gagctagaag agcctcctgg 181 agaataatca gcagcattga acagaaagaa gaaaacaagg gaggagaaga caagctaaaa 241 atgattcggg aatatcggca aatggttgag actgagctaa agttaatctg ttgtgacatt 301 ctggatgtac tggacaaaca cctcattcca gcagctaaca ctggcgagtc caaggttttc 361 tattataaaa tgaaagggga ctaccacagg tatctggcag aatttgccac aggaaacgac 421 aggaaggagg ctgcggagaa cagcctagtg gcttataaag ctgctagtga tattgcaatg 481 acagaacttc caccaacgca tcctattcgc ttaggtcttg ctctcaattt ttccgtattc 541 tactacgaaa ttcttaattc ccctgaccgt gcctgcaggt tggcaaaagc agcttttgat 601 gatgcaattg cagaactgga tacgctgagt gaagaaagct ataaggactc tacacttatc 661 atgcagttgt tacgtgataa tctgacacta tggacttcag acatgcaggg tgacggtgaa 721 gagcagaata aagaagcgct gcaggacgtg gaagacgaaa atcagtag //