LOCUS       BT007156                 624 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens interleukin 24 mRNA, complete cds.
ACCESSION   BT007156
VERSION     BT007156.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 624)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 624)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..624
                     /db_xref="H-InvDB:HIT000100076"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00760X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..624
                     /codon_start=1
                     /product="interleukin 24"
                     /protein_id="AAP35820.1"
                     /translation="MNFQQRLQSLWTLASRPFCPPLLATASQMQMVVLPCLGFTLLLW
                     SQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVS
                     DAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEM
                     FSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL"
BASE COUNT          155 a          161 c          154 g          154 t
ORIGIN      
        1 atgaattttc aacagaggct gcaaagcctg tggactttag ccagcagacc cttctgccct
       61 cctttgctgg cgacagcctc tcaaatgcag atggttgtgc tcccttgcct gggttttacc
      121 ctgcttctct ggagccaggt atcaggggcc cagggccaag aattccactt tgggccctgc
      181 caagtgaagg gggttgttcc ccagaaactg tgggaagcct tctgggctgt gaaagacact
      241 atgcaagctc aggataacat cacgagtgcc cggctgctgc agcaggaggt tctgcagaac
      301 gtctcggatg ctgagagctg ttaccttgtc cacaccctgc tggagttcta cttgaaaact
      361 gttttcaaaa actaccacaa tagaacagtt gaagtcagga ctctgaagtc attctctact
      421 ctggccaaca actttgttct catcgtgtca caactgcaac ccagtcaaga aaatgagatg
      481 ttttccatca gagacagtgc acacaggcgg tttctgctat tccggagagc attcaaacag
      541 ttggacgtag aagcagctct gaccaaagcc cttggggaag tggacattct tctgacctgg
      601 atgcagaaat tctacaagct ctag
//