LOCUS BT007156 624 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens interleukin 24 mRNA, complete cds. ACCESSION BT007156 VERSION BT007156.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 624) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 624) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..624 /db_xref="H-InvDB:HIT000100076" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00760X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..624 /codon_start=1 /product="interleukin 24" /protein_id="AAP35820.1" /translation="MNFQQRLQSLWTLASRPFCPPLLATASQMQMVVLPCLGFTLLLW SQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVS DAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEM FSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL" BASE COUNT 155 a 161 c 154 g 154 t ORIGIN 1 atgaattttc aacagaggct gcaaagcctg tggactttag ccagcagacc cttctgccct 61 cctttgctgg cgacagcctc tcaaatgcag atggttgtgc tcccttgcct gggttttacc 121 ctgcttctct ggagccaggt atcaggggcc cagggccaag aattccactt tgggccctgc 181 caagtgaagg gggttgttcc ccagaaactg tgggaagcct tctgggctgt gaaagacact 241 atgcaagctc aggataacat cacgagtgcc cggctgctgc agcaggaggt tctgcagaac 301 gtctcggatg ctgagagctg ttaccttgtc cacaccctgc tggagttcta cttgaaaact 361 gttttcaaaa actaccacaa tagaacagtt gaagtcagga ctctgaagtc attctctact 421 ctggccaaca actttgttct catcgtgtca caactgcaac ccagtcaaga aaatgagatg 481 ttttccatca gagacagtgc acacaggcgg tttctgctat tccggagagc attcaaacag 541 ttggacgtag aagcagctct gaccaaagcc cttggggaag tggacattct tctgacctgg 601 atgcagaaat tctacaagct ctag //