LOCUS       BT007137                 606 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens proteasome (prosome, macropain) subunit, beta type, 2
            mRNA, complete cds.
ACCESSION   BT007137
VERSION     BT007137.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 606)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 606)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..606
                     /db_xref="H-InvDB:HIT000100057"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00741X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..606
                     /codon_start=1
                     /product="proteasome (prosome, macropain) subunit, beta
                     type, 2"
                     /protein_id="AAP35801.1"
                     /translation="MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILL
                     LCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNL
                     LLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELL
                     RKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS"
BASE COUNT          157 a          159 c          144 g          146 t
ORIGIN      
        1 atggagtacc tcatcggtat ccaaggcccc gactatgttc ttgtcgcctc cgaccgggtg
       61 gccgccagca atattgtcca gatgaaggac gatcatgaca agatgtttaa gatgagtgaa
      121 aagatattac tcctgtgtgt tggagaggct ggagacactg tacagtttgc agaatatatt
      181 cagaaaaacg tgcaacttta taagatgcga aatggatatg aattgtctcc cacggcagca
      241 gctaacttca cacgccgaaa cctggctgac tgtcttcgga gtcggacccc atatcatgtg
      301 aacctcctcc tggctggcta tgatgagcat gaagggccag cgctgtatta catggactac
      361 ctggcagcct tggccaaggc cccttttgca gcccacggct atggtgcctt cctgactctc
      421 agtatcctcg accgatacta cacaccgact atctcacgtg agagggcagt ggaactcctt
      481 aggaaatgtc tggaggagct ccagaaacgc ttcatcctga atctgccaac cttcagtgtt
      541 cgaatcattg acaaaaatgg catccatgac ctggataaca tttccttccc caaacagggc
      601 tcctag
//