LOCUS BT007137 606 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens proteasome (prosome, macropain) subunit, beta type, 2 mRNA, complete cds. ACCESSION BT007137 VERSION BT007137.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 606) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 606) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..606 /db_xref="H-InvDB:HIT000100057" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00741X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..606 /codon_start=1 /product="proteasome (prosome, macropain) subunit, beta type, 2" /protein_id="AAP35801.1" /translation="MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILL LCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNL LLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELL RKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS" BASE COUNT 157 a 159 c 144 g 146 t ORIGIN 1 atggagtacc tcatcggtat ccaaggcccc gactatgttc ttgtcgcctc cgaccgggtg 61 gccgccagca atattgtcca gatgaaggac gatcatgaca agatgtttaa gatgagtgaa 121 aagatattac tcctgtgtgt tggagaggct ggagacactg tacagtttgc agaatatatt 181 cagaaaaacg tgcaacttta taagatgcga aatggatatg aattgtctcc cacggcagca 241 gctaacttca cacgccgaaa cctggctgac tgtcttcgga gtcggacccc atatcatgtg 301 aacctcctcc tggctggcta tgatgagcat gaagggccag cgctgtatta catggactac 361 ctggcagcct tggccaaggc cccttttgca gcccacggct atggtgcctt cctgactctc 421 agtatcctcg accgatacta cacaccgact atctcacgtg agagggcagt ggaactcctt 481 aggaaatgtc tggaggagct ccagaaacgc ttcatcctga atctgccaac cttcagtgtt 541 cgaatcattg acaaaaatgg catccatgac ctggataaca tttccttccc caaacagggc 601 tcctag //