LOCUS BT007117 471 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens zinc finger protein 258 mRNA, complete cds. ACCESSION BT007117 VERSION BT007117.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 471) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 471) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..471 /db_xref="H-InvDB:HIT000100037" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00058X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..471 /codon_start=1 /product="zinc finger protein 258" /protein_id="AAP35781.1" /translation="MKEPLDGECGKAVVPQQELLDKIKEEPDNAQEYGCVQQPKTQES KLKIGGVSSVNERPIAQQLNPGFQLSFASSGPSVLLPSVPAVAIKVFCSGCKKMLYKG QTAYHKTGSTQLFCSTRCITRHSSPACLPPPPKKTCTNCSKYKILNIPFYFTFF" BASE COUNT 137 a 108 c 90 g 136 t ORIGIN 1 atgaaagaac ctttggatgg tgaatgtggc aaagcagtgg taccacagca ggagcttctg 61 gacaaaatta aagaagaacc agacaatgct caagagtatg gatgtgtcca acagccaaaa 121 actcaagaaa gtaaattgaa aattggtggt gtgtcttcag ttaatgagag acctattgcc 181 cagcagttga acccaggctt tcagctttct tttgcatcat ctggcccaag tgtgttgctt 241 ccttcagttc cagctgttgc tattaaggtt ttttgttctg gttgtaaaaa aatgctttat 301 aagggccaaa ctgcatatca taagacagga tctactcagc tcttctgctc cacacgatgc 361 atcaccagac attcttcacc tgcctgcctg ccacctcctc ccaagaaaac ctgcacaaac 421 tgctcgaagt ataaaattct taacatccct ttttacttta ccttttttta g //