LOCUS BT007114 489 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens sorting nexin 3 mRNA, complete cds. ACCESSION BT007114 VERSION BT007114.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 489) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 489) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..489 /db_xref="H-InvDB:HIT000100034" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00722X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..489 /codon_start=1 /product="sorting nexin 3" /protein_id="AAP35778.1" /translation="MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRG RFTTYEIRVKTNLPIFKLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLP FRGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIR HA" BASE COUNT 147 a 109 c 122 g 111 t ORIGIN 1 atggcggaga ccgtggctga cacccggcgg ctgatcacca agccgcagaa cctgaatgac 61 gcctacggac cccccagcaa cttcctcgag atcgatgtga gcaacccgca aacggtgggg 121 gtcggccggg gccgcttcac cacttacgaa atcagggtca agacaaatct tcctattttc 181 aagctgaaag aatctactgt tagaagaaga tacagtgact ttgaatggct gcgaagtgaa 241 ttagaaagag agagcaaggt cgtagttccc ccgctccctg ggaaagcgtt tttgcgtcag 301 cttcctttta gaggagatga tggaatattt gatgacaatt ttattgagga aagaaaacaa 361 gggctggagc agtttataaa caaggtcgct ggtcatcctc tggcacagaa cgaacgttgt 421 cttcacatgt ttttacaaga tgaaataata gataaaagct atactccatc taaaataaga 481 catgcctag //