LOCUS BT007104 387 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344) mRNA, complete cds. ACCESSION BT007104 VERSION BT007104.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 387) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 387) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..387 /db_xref="H-InvDB:HIT000100024" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00191X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..387 /codon_start=1 /product="CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344)" /protein_id="AAP35768.1" /translation="MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNC SSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN GGTSLSEKTVLLLVTPFLAAAWSLHP" BASE COUNT 97 a 93 c 92 g 105 t ORIGIN 1 atgggaatcc aaggagggtc tgtcctgttc gggctgctgc tcgtcctggc tgtcttctgc 61 cattcaggtc atagcctgca gtgctacaac tgtcctaacc caactgctga ctgcaaaaca 121 gccgtcaatt gttcatctga ttttgatgcg tgtctcatta ccaaagctgg gttacaagtg 181 tataacaagt gttggaagtt tgagcattgc aatttcaacg acgtcacaac ccgcttgagg 241 gaaaatgagc taacgtacta ctgctgcaag aaggacctgt gtaactttaa cgaacagctt 301 gaaaatggtg ggacatcctt atcagagaaa acagttcttc tgctggtgac tccatttctg 361 gcagcagcct ggagccttca tccctag //