LOCUS       BT007104                 387 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens CD59 antigen p18-20 (antigen identified by monoclonal
            antibodies 16.3A5, EJ16, EJ30, EL32 and G344) mRNA, complete cds.
ACCESSION   BT007104
VERSION     BT007104.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 387)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 387)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..387
                     /db_xref="H-InvDB:HIT000100024"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00191X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..387
                     /codon_start=1
                     /product="CD59 antigen p18-20 (antigen identified by
                     monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344)"
                     /protein_id="AAP35768.1"
                     /translation="MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNC
                     SSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
                     GGTSLSEKTVLLLVTPFLAAAWSLHP"
BASE COUNT           97 a           93 c           92 g          105 t
ORIGIN      
        1 atgggaatcc aaggagggtc tgtcctgttc gggctgctgc tcgtcctggc tgtcttctgc
       61 cattcaggtc atagcctgca gtgctacaac tgtcctaacc caactgctga ctgcaaaaca
      121 gccgtcaatt gttcatctga ttttgatgcg tgtctcatta ccaaagctgg gttacaagtg
      181 tataacaagt gttggaagtt tgagcattgc aatttcaacg acgtcacaac ccgcttgagg
      241 gaaaatgagc taacgtacta ctgctgcaag aaggacctgt gtaactttaa cgaacagctt
      301 gaaaatggtg ggacatcctt atcagagaaa acagttcttc tgctggtgac tccatttctg
      361 gcagcagcct ggagccttca tccctag
//