LOCUS BT007087 543 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens ADP-ribosylation factor 5 mRNA, complete cds. ACCESSION BT007087 VERSION BT007087.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 543) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 543) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..543 /db_xref="H-InvDB:HIT000100007" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00696X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..543 /codon_start=1 /product="ADP-ribosylation factor 5" /protein_id="AAP35750.1" /translation="MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVT TIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQE SADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCA TQGTGLYDGLDWLSHELSKR" BASE COUNT 128 a 142 c 162 g 111 t ORIGIN 1 atgggcctca ccgtgtccgc gctcttttcg cggatcttcg ggaagaagca gatgcggatt 61 ctcatggttg gcttggatgc ggctggcaag accacaatcc tgtacaaact gaagttgggg 121 gagattgtca ccaccatccc aaccataggc ttcaatgtag aaacagtgga atataagaac 181 atctgtttca cagtctggga cgtgggaggc caggacaaga ttcggcctct gtggcggcac 241 tacttccaga acactcaggg cctcatcttt gtggtggaca gtaatgaccg ggagcgggtc 301 caagaatctg ctgatgaact ccagaagatg ctgcaggagg acgagctgcg ggatgcagtg 361 ctgctggtat ttgccaacaa gcaggacatg cccaacgcca tgcccgtgag cgagctgact 421 gacaagctgg ggctacagca cttacgcagc cgcacgtggt atgtccaggc cacctgtgcc 481 acccaaggca caggtctgta cgatggtctg gactggctgt cccacgagct gtcaaagcgc 541 tag //