LOCUS BT007084 510 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens ethanolamine kinase mRNA, complete cds. ACCESSION BT007084 VERSION BT007084.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 510) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 510) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..510 /db_xref="H-InvDB:HIT000100004" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00691X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..510 /codon_start=1 /product="ethanolamine kinase" /protein_id="AAP35747.1" /translation="MANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHW DPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQA HGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFSLSSLTLCKGKTTRCFGLTGCR GSRLLLSFF" BASE COUNT 133 a 121 c 130 g 126 t ORIGIN 1 atggccaatt acatccacgt ccctcccggc tccccggagg tgcccaagct gaacgtcacc 61 gttcaggatc aggaggagca tcgctgccgg gagggggccc tgagcctcct gcaacacctg 121 cggcctcact gggaccccca ggaggtgacc ctgcagctct tcacagatgg aatcacaaat 181 aaacttattg gctgttacgt gggaaacacc atggaggatg tagtcctggt gagaatttat 241 ggcaataaga ctgagttatt agtcgatcga gatgaggaag taaagagttt tcgagtgttg 301 caggctcatg ggtgtgcacc acaactctac tgtaccttca ataatggact atgctatgaa 361 tttatacaag gagaagcact ggatccaaag catgtctgca acccagccat tttcagttta 421 tcatcgttga ctctttgcaa aggaaaaact acaagatgtt ttggattaac cggctgcaga 481 gggtcaaggc ttctgcttag ttttttctag //