LOCUS BT007080 336 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens chemokine (C-X-C motif) ligand 14 mRNA, complete cds. ACCESSION BT007080 VERSION BT007080.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 336) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 336) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..336 /db_xref="H-InvDB:HIT000100000" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00687X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..336 /codon_start=1 /product="chemokine (C-X-C motif) ligand 14" /protein_id="AAP35743.1" /translation="MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGP KIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAW NEKRRVYEE" BASE COUNT 80 a 105 c 100 g 51 t ORIGIN 1 atgtccctgc tcccacgccg cgcccctccg gtcagcatga ggctcctggc ggccgcgctg 61 ctcctgctgc tgctggcgct gtacaccgcg cgtgtggacg ggtccaaatg caagtgctcc 121 cggaagggac ccaagatccg ctacagcgac gtgaagaagc tggaaatgaa gccaaagtac 181 ccgcactgcg aggagaagat ggttatcatc accaccaaga gcgtgtccag gtaccgaggt 241 caggagcact gcctgcaccc caagctgcag agcaccaagc gcttcatcaa gtggtacaac 301 gcctggaacg agaagcgcag ggtctacgaa gaatag //