LOCUS BT007071 459 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens ubiquitin-conjugating enzyme E2B (RAD6 homolog) mRNA, complete cds. ACCESSION BT007071 VERSION BT007071.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 459) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 459) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..459 /db_xref="H-InvDB:HIT000099991" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00678X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..459 /codon_start=1 /product="ubiquitin-conjugating enzyme E2B (RAD6 homolog)" /protein_id="AAP35734.1" /translation="MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPE GTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDV SSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS" BASE COUNT 146 a 92 c 100 g 121 t ORIGIN 1 atgtcgaccc cggcccggag gaggctcatg cgggatttca agcggttaca agaggaccca 61 cctgtgggtg tcagtggcgc accatctgaa aacaacatca tgcagtggaa tgcagttata 121 tttggaccag aagggacacc ttttgaagat ggtactttta aactagtaat agaattttct 181 gaagaatatc caaataaacc accaactgtt aggtttttat ccaaaatgtt tcatccaaat 241 gtgtatgctg atggtagcat atgtttagat atccttcaga atcgatggag tccaacatat 301 gatgtatctt ctatcttaac atcaattcag tctctgctgg atgaaccgaa tcctaacagt 361 ccagccaata gccaggcagc acagctttat caggaaaaca aacgagaata tgagaaaaga 421 gtttcggcca ttgttgaaca aagctggaat gattcatag //